Protein Info for HP15_765 in Marinobacter adhaerens HP15

Annotation: threonine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to THRC_PSEAE: Threonine synthase (thrC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01733, threonine synthase [EC: 4.2.3.1] (inferred from 94% identity to maq:Maqu_2273)

Predicted SEED Role

"Threonine synthase (EC 4.2.3.1)" in subsystem Threonine and Homoserine Biosynthesis (EC 4.2.3.1)

MetaCyc Pathways

aspartate superpathway (23/25 steps found)
superpathway of L-isoleucine biosynthesis I (13/13 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis I (16/18 steps found)
superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
superpathway of L-threonine biosynthesis (6/6 steps found)
L-threonine biosynthesis (2/2 steps found)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQI6 at UniProt or InterPro

Protein Sequence (466 amino acids)

>HP15_765 threonine synthase (Marinobacter adhaerens HP15)
MRYISTRGEAPALGFEDVLLTGLATDGGLYVPESLPHFDLEEIRSWRGLSYSELAFNVMY
PFVDDAIPADDFRKMLDETYSVFAHKAVAPLVQLDTNEWVMELFRGPTLAFKDFALQLLG
RLLDYVLEKRKQHVVIMGATSGDTGSAAIEGCRRCEHVDIFILHPYQRVSEVQRRQMTTV
QGENIHNIAVRGNFDDCQRMVKESFGNQSFLGGKTQLAAVNSINWARIMAQIVYYFHASL
ALGGPDRSMAFSVPTGNFGDIFAGYLAKKMGLPISQLVIATNRNDILHRFMSGNKYEQHQ
LEHTLSPSMDIMVSSNFERLLFDLHGRDGLAVKTLLENAAKGPVSIEDYRWKHARKLFDS
DAVDDKATCDTIREIYEQNEYLLDPHTAIGVRAARNCRRDQAVPMITLGTAHPAKFPDAV
AESGVSVEPPLPAHMADLFEREERYTVLDNNIDGVQAFIAKHWKNA