Protein Info for PGA1_c07970 in Phaeobacter inhibens DSM 17395

Annotation: putative membrane transport protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 310 transmembrane" amino acids 6 to 23 (18 residues), see Phobius details amino acids 42 to 60 (19 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 171 to 191 (21 residues), see Phobius details amino acids 197 to 218 (22 residues), see Phobius details amino acids 228 to 248 (21 residues), see Phobius details amino acids 257 to 277 (21 residues), see Phobius details amino acids 287 to 308 (22 residues), see Phobius details PF03547: Mem_trans" amino acids 8 to 306 (299 residues), 115 bits, see alignment E=1.5e-37

Best Hits

KEGG orthology group: K07088, (no description) (inferred from 74% identity to sil:SPO2744)

Predicted SEED Role

"malonate transporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXC7 at UniProt or InterPro

Protein Sequence (310 amino acids)

>PGA1_c07970 putative membrane transport protein (Phaeobacter inhibens DSM 17395)
MFQSLIDVILPVFLVIGAGYVATRRGYFQASHVDGLMKFTQSFAIPCLLFRAIATLDLSA
SFDPRLLISFYTGAAICFSLGMIGARLIFKRDWEDCVAIGFCCLFSNSVLLGLPITERAY
GADNLTGNYAIIAFHSPFCYGLGITVMEIVRNKGAGGIATVKSVFSAMFKNVLILGIALG
FVVNLSGLWIPQAVDEALSLVIRAALPTALFALGGVLVQYRPEGDLRAIGFVCAISLMVH
PALVWSMGSALKVQPDLFRSAVLNAAMAPGFNAYIFANMYGRAKRVAASSVLIATGSCIL
TVWLWLLILG