Protein Info for PGA1_c07960 in Phaeobacter inhibens DSM 17395

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 43 to 70 (28 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 109 to 134 (26 residues), see Phobius details amino acids 139 to 140 (2 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 169 to 189 (21 residues), see Phobius details amino acids 202 to 224 (23 residues), see Phobius details amino acids 262 to 283 (22 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 358 to 381 (24 residues), see Phobius details amino acids 393 to 410 (18 residues), see Phobius details amino acids 417 to 447 (31 residues), see Phobius details amino acids 470 to 489 (20 residues), see Phobius details PF01970: TctA" amino acids 18 to 441 (424 residues), 466.2 bits, see alignment E=4.5e-144

Best Hits

KEGG orthology group: K07793, putative tricarboxylic transport membrane protein (inferred from 91% identity to sil:SPO0184)

Predicted SEED Role

"Tricarboxylate transport membrane protein TctA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYI6 at UniProt or InterPro

Protein Sequence (505 amino acids)

>PGA1_c07960 putative integral membrane protein (Phaeobacter inhibens DSM 17395)
MLDGILIGLSTAFSFSNILMVIGGCLIGTFIGMLPGLGPMSIISIMIPVAISIGDPSAAL
ILLAGVYYGAIFGGSTSSILINAPGVASTVATSFDGYPLARQGKAGKALTVAAISSFCGG
SIGAVLLMIFAPALASVALLFHSAEYFALMVVGLSAIAAFAGTGQVVKALLMTVLGLIMA
TVGEGALFNMPRFTMGIMDLQSGFGFITLAMAMFALPEALYLVLDPSRSKTEGGSNEIKD
LRITRAEAKSIAPVIGRQSIQGFLIGVLPGAGATIASFLGYAVERNIAPKEEQKEFGKGA
IKGLAAPESANNAACTGSFVPLLTLGIPGSGTTAILLGALIALNVSPGPRLMVDEPEIFW
AVIISMYVGNLILLVLNLPLIPYIAKVLAVPRNYLIPFIFFFTLMGAYIGQNNATELLIL
VGLGICATVLRFADYPLAPLLIGFILGSMLEDNFSRSMQLYDGLGFLMERPMTIGLLGLA
ALLVILPSYRARRARLRQRGVADGD