Protein Info for Psest_0795 in Pseudomonas stutzeri RCH2

Annotation: ABC-type multidrug transport system, ATPase component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 308 PF00005: ABC_tran" amino acids 19 to 156 (138 residues), 124.6 bits, see alignment E=4.5e-40 PF13304: AAA_21" amino acids 124 to 186 (63 residues), 33.9 bits, see alignment E=3.8e-12

Best Hits

Swiss-Prot: 98% identical to NOSF_PSEST: Probable ABC transporter ATP-binding protein NosF (nosF) from Pseudomonas stutzeri

KEGG orthology group: K01990, ABC-2 type transport system ATP-binding protein (inferred from 96% identity to psa:PST_3548)

Predicted SEED Role

"Nitrous oxide reductase maturation protein NosF (ATPase)" in subsystem Denitrification

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GF62 at UniProt or InterPro

Protein Sequence (308 amino acids)

>Psest_0795 ABC-type multidrug transport system, ATPase component (Pseudomonas stutzeri RCH2)
MNAVEIQGVSQRYGSMTVLHDLNLNLGEGEVLGLFGHNGAGKTTSMKLILGLLAPSEGQV
KVLGRAPNDPQVRRQLGYLPENVTFYPQLSGRETLRHFARLKGAALTQVDELLEQVGLAH
AADRRVKTYSKGMRQRLGLAQALLGEPKLLLLDEPTVGLDPIATQDLYQLIDRLRQRGTS
IILCSHVLPGVEAHINRAAILAKGRLQAVGSLSQLRAEAGLPVRIRASGVSERDSWLQRW
TDAGHSARGLSESSLEVVAVNGHKLVLLRQLLGESEPEDIEIHQPSLEDLYRYYMERAGD
VRAQEGRP