Protein Info for HP15_756 in Marinobacter adhaerens HP15

Annotation: cytochrome c assembly protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 274 transmembrane" amino acids 6 to 27 (22 residues), see Phobius details amino acids 38 to 58 (21 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 98 to 118 (21 residues), see Phobius details amino acids 131 to 156 (26 residues), see Phobius details amino acids 182 to 205 (24 residues), see Phobius details amino acids 217 to 235 (19 residues), see Phobius details amino acids 247 to 269 (23 residues), see Phobius details PF01578: Cytochrom_C_asm" amino acids 43 to 268 (226 residues), 106.1 bits, see alignment E=1.1e-34

Best Hits

KEGG orthology group: None (inferred from 87% identity to maq:Maqu_2312)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQH7 at UniProt or InterPro

Protein Sequence (274 amino acids)

>HP15_756 cytochrome c assembly protein (Marinobacter adhaerens HP15)
MVNKEVMGTLILAVTSLFLYSVGTALQALHFRGRVQSNIAITTLIGVLALTSHGLLIGQT
VHHDGGFDFSFFKSSVLISWLIVFLLLGLNLKKPVQSLFLGVYPLAGLTIILALVTHGPS
RLVSEQSYGMLSHIALSVTAYSLFTLAAIQAVLLYFQNRQLKHNYNSLLVRNLPPLQTME
SLLFEMVWAGVVMLILAIVTGALFIEDLFAQNLAHKTLFSILSLLVFVALLIGRYTKGWR
GITASRWTLAGCALLMLAFYGSKFVLELIFQRGV