Protein Info for PGA1_c07880 in Phaeobacter inhibens DSM 17395

Annotation: alpha-glucoside transport system permease protein AglG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 175 to 202 (28 residues), see Phobius details amino acids 209 to 231 (23 residues), see Phobius details amino acids 243 to 263 (21 residues), see Phobius details amino acids 285 to 310 (26 residues), see Phobius details amino acids 316 to 332 (17 residues), see Phobius details amino acids 349 to 368 (20 residues), see Phobius details PF00528: BPD_transp_1" amino acids 189 to 375 (187 residues), 36.8 bits, see alignment E=1.7e-13

Best Hits

Swiss-Prot: 59% identical to AGLG_RHIME: Alpha-glucoside transport system permease protein AglG (aglG) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K10234, alpha-glucoside transport system permease protein (inferred from 85% identity to sit:TM1040_3305)

Predicted SEED Role

"Alpha-glucoside transport system permease protein AglG"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DN24 at UniProt or InterPro

Protein Sequence (382 amino acids)

>PGA1_c07880 alpha-glucoside transport system permease protein AglG (Phaeobacter inhibens DSM 17395)
MTVIAGEKPALIWALRLSVVLLVGLWLFPTLGLLVSSFRTSDQIATSGWWRAMFPSEQNL
TLRTNPPSAQVQEGDRYVIEGRLFAEGTSSEISAWGTSARDPAAYEPGISAELRRGGTLT
VTEDGAYRLESTEEISGKRGPRVFVTATVPPEFTLENYETVLISGNSTDNMAKAFFNTLT
VTIPATIIPILVAAFAAYALAWMEFPGRALLVAAIVGLLVVPLQLALIPLLKFHNEIGIG
KGYIGVWMAHTGFGLPLAIYLLRNYMVGIPRDIIENARVDGATDFLIFVRIILPLSFPAL
ASFAIFQFLWTWNDLLVAMVFLIDATGETTVMTKQIVELLGTRGGNWEILATSAFVSIAV
PLAVFFAMQKYLVRGLLAGSVK