Protein Info for HP15_749 in Marinobacter adhaerens HP15

Annotation: iron(III) ABC transporter, ATP-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00005: ABC_tran" amino acids 28 to 172 (145 residues), 123.5 bits, see alignment E=1.5e-39 PF08402: TOBE_2" amino acids 284 to 353 (70 residues), 33.5 bits, see alignment E=5.5e-12

Best Hits

KEGG orthology group: K02010, iron(III) transport system ATP-binding protein [EC: 3.6.3.30] (inferred from 93% identity to maq:Maqu_2318)

Predicted SEED Role

"Ferric iron ABC transporter, ATP-binding protein" in subsystem Iron acquisition in Vibrio or Transport of Iron

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.30

Use Curated BLAST to search for 3.6.3.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQH0 at UniProt or InterPro

Protein Sequence (357 amino acids)

>HP15_749 iron(III) ABC transporter, ATP-binding protein (Marinobacter adhaerens HP15)
MSTTAQSPADWLLEVNNLSCGYGGDSVVKDVSFALSHGDIGCLLGPSGCGKSTILRALAG
FLPLSGGEISLQSQAISLPGRTLPPEKRRIGMVFQDYALFPHLTIADNVGFGLRNLNKAE
KRQKVMELLNVVHLQDLADNYPHELSGGQQQRVALARALAPEPTLILLDEPFSNLDADLR
RRLSLDVREILKTLGISAILVTHDQQEAFAMCDQVAVLRDGRIQQWDVPYNLYHEPANRF
VASFVGQGGFVPGTALGPDTIESELGVIHGNRAYKWEPGTLVDVLIRPDDIVHDPDSDLQ
PKVVEKTFAGTSTLYRFRCSEDTEFEALFRSHLDFNLGEHVPVRVEADHLIAFERTT