Protein Info for HP15_748 in Marinobacter adhaerens HP15

Annotation: glycerol kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 493 PF00370: FGGY_N" amino acids 4 to 250 (247 residues), 262.2 bits, see alignment E=5.1e-82 TIGR01311: glycerol kinase" amino acids 4 to 491 (488 residues), 707.8 bits, see alignment E=2.8e-217 PF02782: FGGY_C" amino acids 260 to 446 (187 residues), 148.7 bits, see alignment E=2e-47

Best Hits

Swiss-Prot: 84% identical to GLPK_MARHV: Glycerol kinase (glpK) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00864, glycerol kinase [EC: 2.7.1.30] (inferred from 84% identity to maq:Maqu_2319)

Predicted SEED Role

"Glycerol kinase (EC 2.7.1.30)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or MLST (EC 2.7.1.30)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.30

Use Curated BLAST to search for 2.7.1.30

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQG9 at UniProt or InterPro

Protein Sequence (493 amino acids)

>HP15_748 glycerol kinase (Marinobacter adhaerens HP15)
MTRYLLAIDQGTTSSRAIVFDQTGNSVATDQQEFHQYFPKDGWVEHDAREIWDSTLAVCR
GALDKAGIDASELAGIGITNQRETTVIWDRATGEPIYHAIVWQDRRTASWCTKLKSDGHE
DTVVERTGLLIDPYFSATKIAWILDNVEGARARAESGALAFGTVDSWLLWNLTNGKSHCT
DATNASRTALFNIHKQDWDDDLLALFRVPRALLPEVLDSAADYGTAEAQWLGAPVMIAGI
AGDQHAALVGQACFYPGMAKSTYGTGCFLMLNTGDKAVRSENRLLTTMAYRLNGKPCYAV
EGSIFVAGAAMQWLRDGLKLIAHANESSAHAEAVGVDNPVYLVPAFTGLGAPHWDPHARG
AIMGLTRDTGIGEIVTAGLQSVCYQTKDLVRAIQNDGARLESLRVDGGMVVNDWVMQFLA
DILNVTVDRPRVTETTALGAAYLAGLQTGVFDNLEQISALWECERQFHPEMRPALRESLY
AGWLDAVERVCNN