Protein Info for PGA1_c07820 in Phaeobacter inhibens DSM 17395

Annotation: putative peptidase M22

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 394 PF01321: Creatinase_N" amino acids 16 to 160 (145 residues), 69.7 bits, see alignment E=3.7e-23 PF00557: Peptidase_M24" amino acids 169 to 375 (207 residues), 107.5 bits, see alignment E=8.5e-35

Best Hits

Swiss-Prot: 53% identical to DOEA_HALED: Ectoine hydrolase (doeA) from Halomonas elongata (strain ATCC 33173 / DSM 2581 / NBRC 15536 / NCIMB 2198 / 1H9)

KEGG orthology group: K01271, Xaa-Pro dipeptidase [EC: 3.4.13.9] (inferred from 64% identity to pgv:SL003B_2647)

MetaCyc: 53% identical to ectoine hydrolase (Halomonas elongata DSM 2581)
RXN-18397 [EC: 3.5.4.44]

Predicted SEED Role

"Peptidase M24"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.13.9 or 3.5.4.44

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EXB4 at UniProt or InterPro

Protein Sequence (394 amino acids)

>PGA1_c07820 putative peptidase M22 (Phaeobacter inhibens DSM 17395)
MTKPQTPFTQSEYQHRLDKTRAAMAAAGLDALFVTDPSNQAWLTGYDGWSFYVHQGVIIP
QDGDPIWWGRHMDMMGARRTCWMPQDRLLGYGDHFVQSTDRHPMQDLAGHLCALGLERAR
IGVEMENYYYSAKAHAVLAAELPQADLVDATALVNWQRLVKSDAEISFMRKAARITDKVI
QTALERAAPGVRKNDLVADILHAGVTGVGDDWGDYPAIVPLTPSGLDATAAHLTWDGTPM
RQGEATFFELSGCYRRYHAPLSRTVFLGTPPAEMLRTEAAQIEGIAAGIEAARAGNRTCD
IANAFMAVMAKHGIERSGRMGYPVGLSYPPDWGERTASIRSEDTTVLQPGMVFHFMPALW
MDTWGLETTETLLIRDTGAAEPLCSIERKLFVKG