Protein Info for Psest_0777 in Pseudomonas stutzeri RCH2

Annotation: cyanate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00673: cyanase
  • amino acids 4 to 149 (146 residues), 167.5 bits, E=9.6e-54
• PF21291: CYNS_N
  • amino acids 5 to 73 (69 residues), 95 bits, E=2.1e-31
• PF02560: Cyanate_lyase
  • amino acids 81 to 147 (67 residues), 121.4 bits, E=1.1e-39

Best Hits

Swiss-Prot: 77% identical to CYNS_POLAQ: Cyanate hydratase (cynS) from Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1)

KEGG orthology group: K01725, cyanate lyase [EC: 4.2.1.104] (inferred from 97% identity to psa:PST_3566)

MetaCyc: 39% identical to cyanase (Escherichia coli K-12 substr. MG1655)
Cyanase. [EC: 4.2.1.104]

Predicted SEED Role

"Cyanate hydratase (EC 4.2.1.104)" in subsystem Cyanate hydrolysis (EC 4.2.1.104)

MetaCyc Pathways

• L-arginine degradation V (arginine deiminase pathway) (4/4 steps found)
• L-citrulline degradation (3/3 steps found)
• cyanate degradation (3/3 steps found)
• urea degradation I (3/3 steps found)
• superpathway of allantoin degradation in yeast (5/6 steps found)
• cyanuric acid degradation II (4/5 steps found)
• cyanuric acid degradation I (2/5 steps found)
• uracil degradation III (2/5 steps found)
• superpathway of atrazine degradation (4/8 steps found)
• allantoin degradation IV (anaerobic) (2/9 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.104

Sequence Analysis Tools

See L0GIZ2 at UniProt or InterPro

Protein Sequence (149 amino acids)

>Psest_0777 cyanate hydratase (Pseudomonas stutzeri RCH2)
MISSREQVTQMIVSAKVRKGLKWAHVAESIGMSKEWTTAGCLGQMAFDKAQAETLGQLFE
LSDEAVAWLQIAPYKGSLPTAVPSDPLIYRWYELVNVYGTTIKELIHEEFGDGIMSAIDF
SMDIQRQSDPKGDRVSVVLSGKFLPYKSY