Protein Info for PGA1_c07760 in Phaeobacter inhibens DSM 17395

Annotation: TRAP transporter, subunit DctM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 442 transmembrane" amino acids 20 to 47 (28 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details amino acids 107 to 131 (25 residues), see Phobius details amino acids 148 to 176 (29 residues), see Phobius details amino acids 182 to 204 (23 residues), see Phobius details amino acids 233 to 252 (20 residues), see Phobius details amino acids 258 to 278 (21 residues), see Phobius details amino acids 290 to 311 (22 residues), see Phobius details amino acids 330 to 359 (30 residues), see Phobius details amino acids 371 to 396 (26 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details PF06808: DctM" amino acids 20 to 432 (413 residues), 301.6 bits, see alignment E=4.3e-94 TIGR00786: TRAP transporter, DctM subunit" amino acids 30 to 436 (407 residues), 302.1 bits, see alignment E=2.8e-94

Best Hits

KEGG orthology group: None (inferred from 90% identity to sil:SPO0593)

Predicted SEED Role

"TRAP-type C4-dicarboxylate transport system, large permease component"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYH1 at UniProt or InterPro

Protein Sequence (442 amino acids)

>PGA1_c07760 TRAP transporter, subunit DctM (Phaeobacter inhibens DSM 17395)
MLWNSLNQTVELGWDFYLPVILFVALIALAVPVWAAIGAAAITMLVMSGDLPLSAIGESL
FTGIDAFALTAVPLFILTGDVLVRTGLSKKFLDVAEALTCWTRGGFGSATVLVCGMFAAI
SGSDAAGAAAVGRMTIARLVESGYPRPYACALVAAGACTGILIPPSIAYIIIGLVLGISA
STLFLAALIPGIAILVSILVTNIIMNRLYTYETGGNMGLGEWLGNLGQSLKSGWYAFIVP
GIIFYGIFSGRLTPTEAGATAVVVTILMGFLLGTLKLADFPAMLVSSAKVNGVILPIIAF
SAPLAEALAIMGVPQGFVTAVTGLTDDPSILILLMICILIAAGCVMETTPNIVILAPILK
PLADNIGMNEIQFCIMMITALGVGFITPPLGLNLFVVSGITGESILKIAARAIPFVLTML
IVVLLIAYLPAISTTLLPDIYK