Protein Info for HP15_738 in Marinobacter adhaerens HP15

Annotation: phosphoesterase, PA-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 111 transmembrane" amino acids 56 to 84 (29 residues), see Phobius details amino acids 90 to 109 (20 residues), see Phobius details PF01569: PAP2" amino acids 5 to 110 (106 residues), 74.2 bits, see alignment E=8.7e-25 PF14378: PAP2_3" amino acids 41 to 101 (61 residues), 34.7 bits, see alignment E=1.6e-12

Best Hits

Predicted SEED Role

"Phosphatidylglycerophosphatase B (EC 3.1.3.27)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 3.1.3.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.27

Use Curated BLAST to search for 3.1.3.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQF9 at UniProt or InterPro

Protein Sequence (111 amino acids)

>HP15_738 phosphoesterase, PA-phosphatase (Marinobacter adhaerens HP15)
MALTGLTCTLSYKLLKRWLIRERPFISFPAINCGTRPLDRYSFPSGHTLHAACFQVMLTV
AEPALALIVLPFTLSVAASRVVLGLHYPSDVAAGALIGGLMGYAAMSWLQF