Protein Info for Psest_0771 in Pseudomonas stutzeri RCH2

Annotation: Acyl-CoA hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 167 PF03061: 4HBT" amino acids 23 to 97 (75 residues), 68.4 bits, see alignment E=2.8e-23

Best Hits

Swiss-Prot: 38% identical to Y654_CHLPN: Uncharacterized acyl-CoA thioester hydrolase CPn_0654/CP_0093/CPj0654/CpB0680 (CPn_0654) from Chlamydia pneumoniae

KEGG orthology group: None (inferred from 98% identity to psa:PST_3573)

Predicted SEED Role

"cytosolic long-chain acyl-CoA thioester hydrolase family protein" in subsystem Serine-glyoxylate cycle

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GJ66 at UniProt or InterPro

Protein Sequence (167 amino acids)

>Psest_0771 Acyl-CoA hydrolase (Pseudomonas stutzeri RCH2)
MLDGHAELTMTVLMTPDKANFSGNVHGGTLLKYLDEVAYACASRYAGQYVVTLSVDQVVF
RQPVHVGELVTFLASVNYTGTTSMEIGIKVVTEDIREKTVRHTNSCFFTMVALGEDGKPV
PVPPLNPKTAEQQRRFAQAYQRREIRRELEHRYSELRAGNERLTAVK