Protein Info for PGA1_c07690 in Phaeobacter inhibens DSM 17395

Annotation: (S)-mandelate dehydrogenase MdlB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF01070: FMN_dh" amino acids 16 to 362 (347 residues), 398.1 bits, see alignment E=3.4e-123 PF00478: IMPDH" amino acids 219 to 335 (117 residues), 26.5 bits, see alignment E=3.3e-10

Best Hits

KEGG orthology group: None (inferred from 72% identity to jan:Jann_1403)

MetaCyc: 73% identical to sulfolactate dehydrogenase (Roseovarius nubinhibens ISM)
1.1.1.-

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.2.3)" in subsystem L-rhamnose utilization or Lactate utilization or Respiratory dehydrogenases 1 (EC 1.1.2.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.2.3

Use Curated BLAST to search for 1.1.2.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUU6 at UniProt or InterPro

Protein Sequence (363 amino acids)

>PGA1_c07690 (S)-mandelate dehydrogenase MdlB (Phaeobacter inhibens DSM 17395)
MGAGAIHSAEDARRLARRRLPWMVFDYIDGAAGQETGAARNRAALDAITLRPRILRDVSQ
RSLATSIFGAETDRPFGIAPMGMCNLAAPGADLMLARLAAHHRVPHGVSTVASTPLEILL
EAAEGYAWFQLYFSGDGTGTFKLAERARAAGYQTLVLTVDVPEVGRRPRELRHGFKMPFR
IGPRQFIDFALHPRWSLATLLKGKPVMANFEMEGYDFDRTESRARATWDTLARLRDLWPG
KLVVKGVLDVEDARALVSAGADAIQISSHGARQLEAAPAPIEMLAKIRADFGPTFPVFYD
SGIRSGEDVLKAITTGADFVFLGRILQYAIAARGEAGLEQLWDALSEELSIAMAQTGRVS
LAT