Protein Info for HP15_722 in Marinobacter adhaerens HP15

Updated annotation (from data): TRAP transporter for fumarate, succinate, L-malate, and 2-oxoglutarate, solute receptor component
Rationale: Important for utilization of fumarate, succinate, L-malate, and 2-oxoglutarate. Also important in many nitrogen source experiments with 2-oxoglutarate as the carbon source.
Original annotation: immunogenic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR02122: TRAP transporter solute receptor, TAXI family" amino acids 1 to 316 (316 residues), 169.2 bits, see alignment E=5.4e-54 PF16868: NMT1_3" amino acids 35 to 316 (282 residues), 220.5 bits, see alignment E=1.9e-69

Best Hits

KEGG orthology group: None (inferred from 88% identity to maq:Maqu_2350)

Predicted SEED Role

"TRAP transporter solute receptor, TAXI family precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQE3 at UniProt or InterPro

Protein Sequence (325 amino acids)

>HP15_722 TRAP transporter for fumarate, succinate, L-malate, and 2-oxoglutarate, solute receptor component (Marinobacter adhaerens HP15)
MKTQAVMAVAFASTFAVATPATAQDRSDWPSNFTVGTASQGGTYFAYGSGWANFVAENLG
VSGGAEITGGPVQNMALVHTGDLKFGLTTMGPARESMDGNSPLAPGMKMDNVCAMFPMYE
TPFSVTALSSSGITSIADIPDGATIGFGPAGSTSDTYFPRMMETLGVNFERRNGSWSDLG
GQLQDGLIDVVAFAAGIPIPAVSQLEVQTDVNIIGMNDAEAETIISNFPVSEFIIPASTY
QSLDAPSRVVSMWNFAMVNCDVSESFVYEITKLTMENNDKMVSIHKAARNSVPENYTKNN
VLPWHPGAARWFNENGYPIEDSQIK