Protein Info for PGA1_c00760 in Phaeobacter inhibens DSM 17395

Annotation: putative pyruvate dehydrogenase complex repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF00392: GntR" amino acids 12 to 74 (63 residues), 71 bits, see alignment E=5.1e-24 PF07729: FCD" amino acids 101 to 226 (126 residues), 83.3 bits, see alignment E=2e-27

Best Hits

Swiss-Prot: 36% identical to PDHR_SALTI: Pyruvate dehydrogenase complex repressor (pdhR) from Salmonella typhi

KEGG orthology group: K05799, GntR family transcriptional regulator, transcriptional repressor for pyruvate dehydrogenase complex (inferred from 79% identity to sit:TM1040_2589)

Predicted SEED Role

"Glycolate utilization operon transcriptional activator GlcC" in subsystem Glycolate, glyoxylate interconversions

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7ET47 at UniProt or InterPro

Protein Sequence (256 amino acids)

>PGA1_c00760 putative pyruvate dehydrogenase complex repressor (Phaeobacter inhibens DSM 17395)
MPFQKVQPEKLSASVVRQIEQFILRGILTPGERLPAERELAERLGVSRPSLRDALAELQD
RGLLVSRAGAGVFVADVLGSAFSPALVQLFASHDEAVFDYLSFRRDMEGLAAERAAKYGS
DYDLEVIQTIFEKMEQAGDPATSEEAAALDAQFHSAIMDASHNVVMLHMMRSMFELLREG
VFYNRRVMFQQHTTRDALLAQHSAINAALQARDPSAARAAVETHLDYVKQALTDHQRALR
NAEVAKQRLQHETGKT