Protein Info for Psest_0753 in Pseudomonas stutzeri RCH2

Annotation: NADH:flavin oxidoreductases, Old Yellow Enzyme family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details PF00724: Oxidored_FMN" amino acids 6 to 350 (345 residues), 289.1 bits, see alignment E=2.7e-90

Best Hits

KEGG orthology group: K10680, N-ethylmaleimide reductase [EC: 1.-.-.-] (inferred from 78% identity to avn:Avin_18430)

Predicted SEED Role

"N-ethylmaleimide reductase (EC 1.-.-.-)" (EC 1.-.-.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.-.-.-

Use Curated BLAST to search for 1.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH63 at UniProt or InterPro

Protein Sequence (374 amino acids)

>Psest_0753 NADH:flavin oxidoreductases, Old Yellow Enzyme family (Pseudomonas stutzeri RCH2)
MNHKALFTPASLGSFTLRNRIVLPPLTRSRSSQPGNIPNAVMATYYQQRASAGFMVTEGI
QIEPRGQGYAWTPGIHSPEQVEGWKAVTQAVHAEGGVIFAQLWHVGRVSHTSLQPGGAQP
VAPSAIAATNVKVFIETGPGEGALVEPSMPRALSNAEVKELVQLYAEAARNAMEAGFDGI
EIHCANGYLVNQFISAHTNRRTDEYGGSLQNRLRFMHEAVQAIADAIGAERVGVRFAPLF
ASTDEERVYLGLVEQDPHETYIEAVKILQTIGVAYVSLAEADWDTAPELPSSFREAVRAA
FNGAIIYAGKYTPERATAAIEAGWADLIAFGRPFIANPDLPARIARGWPMNPLDASSMYG
GTEKGYIDYPVHAH