Protein Info for HP15_717 in Marinobacter adhaerens HP15

Annotation: MscS Mechanosensitive ion channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 286 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 52 to 69 (18 residues), see Phobius details amino acids 75 to 95 (21 residues), see Phobius details PF21088: MS_channel_1st" amino acids 52 to 92 (41 residues), 24 bits, see alignment 4.8e-09 PF00924: MS_channel_2nd" amino acids 94 to 160 (67 residues), 74 bits, see alignment E=1.2e-24 PF21082: MS_channel_3rd" amino acids 167 to 248 (82 residues), 48.4 bits, see alignment E=1.6e-16

Best Hits

Swiss-Prot: 33% identical to Y1546_ARCFU: Uncharacterized MscS family protein AF_1546 (AF_1546) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: None (inferred from 78% identity to maq:Maqu_2355)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQD8 at UniProt or InterPro

Protein Sequence (286 amino acids)

>HP15_717 MscS Mechanosensitive ion channel (Marinobacter adhaerens HP15)
MQFFTDIAWGQWISSAFLVVLGLFLGSLAARSVGRFMAQRTSRHHTVMVRRLVFYVIVVL
FFVAALREAGFSLDVVLGAAGILTVAIGFASQTSASNMISGLFLLVEKPFEIGDFIEVDA
TIGEVVGIDMLSVKLRTPDNLYVRIPNETLIKTRVVNRSRFPIRRLDLTVGIAYAEDVER
VESLLLTLAEKNPVCLEEPKPFTLVTAFGPSSVDLQFSYWVPKEKVLEGRSGMMVAIKKT
LDREGIEIPFPHTSVYAGSHSEPFRVQLLGPEKITEKDLPDVDKDS