Protein Info for HP15_714 in Marinobacter adhaerens HP15

Annotation: molybdopterin synthase sulfurylase MoeB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 52% identical to MOEB_SALTY: Molybdopterin-synthase adenylyltransferase (moeB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K11996, adenylyltransferase and sulfurtransferase (inferred from 81% identity to maq:Maqu_2358)

MetaCyc: 51% identical to molybdopterin-synthase adenylyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11361 [EC: 2.7.7.80]

Predicted SEED Role

"Sulfur carrier protein adenylyltransferase ThiF" in subsystem Thiamin biosynthesis

MetaCyc Pathways

superpathway of thiamine diphosphate biosynthesis I (9/10 steps found)
superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
thiazole component of thiamine diphosphate biosynthesis I (5/6 steps found)
thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
molybdopterin biosynthesis (4/6 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.7.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQD5 at UniProt or InterPro

Protein Sequence (252 amino acids)

>HP15_714 molybdopterin synthase sulfurylase MoeB (Marinobacter adhaerens HP15)
MEMQMLSDDELLRYSRQILMPRFDIAGQEKLQSARVLVIGAGGLGCPVALYLGAAGVGTL
TLVDDDNIELANLQRQIGFETSLLGESKAESLADRIRRINPLVSVIALNQRLEGEALTRT
VTEATLVVDCTDNFNTRFALNRACVASKVPLVSGAAIRGEGQVSVYDSRREDSPCYHCLY
PEQGNEDLTCSEAGVIAPLVGMIGATQAMEAIKVISGVGSPLVGRLLILDAWEMQWREMK
LARDPSCPVCSS