Protein Info for HP15_713 in Marinobacter adhaerens HP15

Annotation: modification methylase, HemK family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 283 PF17827: PrmC_N" amino acids 12 to 78 (67 residues), 67 bits, see alignment E=6.6e-22 TIGR00536: methyltransferase, HemK family" amino acids 17 to 280 (264 residues), 256.4 bits, see alignment E=2.8e-80 TIGR03534: protein-(glutamine-N5) methyltransferase, release factor-specific" amino acids 28 to 275 (248 residues), 294.9 bits, see alignment E=5e-92 PF05175: MTS" amino acids 110 to 195 (86 residues), 62.4 bits, see alignment E=1.5e-20 PF06325: PrmA" amino acids 114 to 187 (74 residues), 25.9 bits, see alignment E=2.4e-09 PF13847: Methyltransf_31" amino acids 116 to 200 (85 residues), 44.1 bits, see alignment E=6.4e-15 PF13649: Methyltransf_25" amino acids 118 to 195 (78 residues), 43.2 bits, see alignment E=1.8e-14 PF08241: Methyltransf_11" amino acids 119 to 187 (69 residues), 30.4 bits, see alignment E=1.7e-10

Best Hits

Swiss-Prot: 57% identical to PRMC_PSEAE: Release factor glutamine methyltransferase (prmC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02493, methyltransferase [EC: 2.1.1.-] (inferred from 66% identity to maq:Maqu_2359)

MetaCyc: 53% identical to protein-(glutamine-N5) methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-14992 [EC: 2.1.1.297]

Predicted SEED Role

"Protein-N(5)-glutamine methyltransferase PrmC, methylates polypeptide chain release factors RF1 and RF2"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.297

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PQD4 at UniProt or InterPro

Protein Sequence (283 amino acids)

>HP15_713 modification methylase, HemK family (Marinobacter adhaerens HP15)
MTSKPSLTCEALLKEASSRIESDSPRLDAELLLSHITGLSRTSFRAWPEREVTDTHAEAF
ERLVQDRVAGRPVAHLLGHQEFWSLPLKVSASTLIPRPDTECLVEVALALPLPRQASVLD
LGTGTGAIALALASEHGGWRISACDAVPEAVALARENAVALGLNLSVVQSSWFSGLEPER
FDLIVSNPPYIPDSDRHLEEGDVRFEPASALVSGSDGLDDLRLIISQAPDWLFEGGWLLV
EHGFDQAEAVAQLFHARGFKAVETRQDYGNRDRMTLGQWSSGA