Protein Info for HP15_710 in Marinobacter adhaerens HP15

Annotation: tetratricopeptide TPR_2 repeat protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 592 signal peptide" amino acids 1 to 33 (33 residues), see Phobius details PF13432: TPR_16" amino acids 242 to 304 (63 residues), 16 bits, see alignment E=9.3e-06 amino acids 310 to 364 (55 residues), 26 bits, see alignment 7.3e-09 amino acids 380 to 439 (60 residues), 17.3 bits, see alignment 3.8e-06 amino acids 444 to 509 (66 residues), 30.3 bits, see alignment E=3.3e-10 PF13174: TPR_6" amino acids 276 to 303 (28 residues), 14.7 bits, see alignment (E = 2.6e-05) PF14559: TPR_19" amino acids 416 to 476 (61 residues), 29.6 bits, see alignment E=4.6e-10 PF13181: TPR_8" amino acids 476 to 508 (33 residues), 13.2 bits, see alignment (E = 5.6e-05)

Best Hits

KEGG orthology group: None (inferred from 71% identity to maq:Maqu_2362)

Predicted SEED Role

"FIG140336: TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPX3 at UniProt or InterPro

Protein Sequence (592 amino acids)

>HP15_710 tetratricopeptide TPR_2 repeat protein (Marinobacter adhaerens HP15)
MRFRQIMGSCMHKSVPFLFTCLLGLTLAGCASLTGTEEAPAKSETVAAGEKTEPQPPVEY
ADFEPETLYLLLSAEIAAQRGRYDITLVNYLKAAKQSRDQVVIERAMRIAQSLNGDNAQK
QLAELWLDIDPDNLQAHRISAIQAVKGNDLQTAIHHMERIMDQGGDADFDSLAAIAANLP
PEQQQELLALYNEMSDRHPDTPELEYSIALLLKVTGQPQQALDRLEPLLQENANFQPAII
LKGDLLYQTGQKSSALDYLLTNTRRFPGNRQMGTLYGRMLINEGELQAAQDEFNRLVKRY
PDTPGLRLSHALVALENGQTDLARQELTQLAEQGHHTSEANYYLGRIEDQASNIEQAIGY
YQSVEQGNYYFPALARASSLLAENGQLEDAIDRIRRLREANPRQAENFWLLEVNLLLDQE
QQQQALSTATEALEEHPDNIEIRYARAMLYDGIGQPADAEADLKRIIEQEPENAVALNAL
GYILTTRTDRLREARGYIEKALRLDPNNPAILDSMGWVLFLEGQLEPALEYLSRAWAAFP
DPEVAAHYGEALWMNGAEEQARIIWQEGLEQDSNHEVLRETIDRLTNGGDTE