Protein Info for Psest_0743 in Pseudomonas stutzeri RCH2

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 TIGR01430: adenosine deaminase" amino acids 41 to 345 (305 residues), 360.9 bits, see alignment E=2.8e-112 PF00962: A_deaminase" amino acids 42 to 344 (303 residues), 295.6 bits, see alignment E=4.5e-92 PF19326: AMP_deaminase" amino acids 222 to 313 (92 residues), 29.3 bits, see alignment E=3.1e-11

Best Hits

Swiss-Prot: 98% identical to ADE_PSEU5: Adenine deaminase (PST_3608) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 98% identity to psa:PST_3608)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GH51 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Psest_0743 adenosine deaminase (Pseudomonas stutzeri RCH2)
MQQCYAGQTGPLAYQLLQPTDRMPAHPQDENFAMHDWLNNLPKAELHLHLEGSLEPELMF
RLAERNKIALPWNDVEALRSAYNFGNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCEE
QNVVHTEPFFDPQTHTDRGIPFEAALNGISAALADGRELLGISSGLILSFLRHLPEEDAF
KTLEQALPYRNAFFAVGLDSSEVGHPPSKFQRVFDKARAEGLLTVAHAGEEGPPEYIWQA
LDLLKVSRIDHGVRAAEDPKLIARLIEEQIPLTVCPLSNTKLKVFADMRQHNILDLLEKG
VKVTVNSDDPAYFGGYVTENFVALHESLGMTEEQARRLAQNSLDARLAY