Protein Info for Psest_0743 in Pseudomonas stutzeri RCH2

Annotation: adenosine deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01430: adenosine deaminase
  • amino acids 41 to 345 (305 residues), 360.9 bits, E=2.8e-112
• PF00962: A_deaminase
  • amino acids 42 to 344 (303 residues), 295.6 bits, E=4.5e-92
• PF19326: AMP_deaminase
  • amino acids 222 to 313 (92 residues), 29.3 bits, E=3.1e-11

Best Hits

Swiss-Prot: 98% identical to ADE_PSEU5: Adenine deaminase (PST_3608) from Pseudomonas stutzeri (strain A1501)

KEGG orthology group: K01488, adenosine deaminase [EC: 3.5.4.4] (inferred from 98% identity to psa:PST_3608)

Predicted SEED Role

"Adenosine deaminase (EC 3.5.4.4)" in subsystem Purine conversions (EC 3.5.4.4)

MetaCyc Pathways

• adenosine nucleotides degradation II (4/5 steps found)
• purine nucleotides degradation II (aerobic) (8/11 steps found)
• adenine and adenosine salvage III (2/4 steps found)
• adenine and adenosine salvage V (1/3 steps found)
• purine deoxyribonucleosides degradation II (1/3 steps found)
• purine deoxyribonucleosides degradation I (1/4 steps found)
• superpathway of purine deoxyribonucleosides degradation (2/7 steps found)
• purine ribonucleosides degradation (1/6 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.4

Sequence Analysis Tools

See L0GH51 at UniProt or InterPro

Protein Sequence (349 amino acids)

>Psest_0743 adenosine deaminase (Pseudomonas stutzeri RCH2)
MQQCYAGQTGPLAYQLLQPTDRMPAHPQDENFAMHDWLNNLPKAELHLHLEGSLEPELMF
RLAERNKIALPWNDVEALRSAYNFGNLQEFLDLYYAGADVLRTEQDFYDLTWAYLQKCEE
QNVVHTEPFFDPQTHTDRGIPFEAALNGISAALADGRELLGISSGLILSFLRHLPEEDAF
KTLEQALPYRNAFFAVGLDSSEVGHPPSKFQRVFDKARAEGLLTVAHAGEEGPPEYIWQA
LDLLKVSRIDHGVRAAEDPKLIARLIEEQIPLTVCPLSNTKLKVFADMRQHNILDLLEKG
VKVTVNSDDPAYFGGYVTENFVALHESLGMTEEQARRLAQNSLDARLAY