Protein Info for PGA1_c07410 in Phaeobacter inhibens DSM 17395

Annotation: binding protein dependent transport system permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 transmembrane" amino acids 32 to 53 (22 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 127 to 147 (21 residues), see Phobius details amino acids 174 to 199 (26 residues), see Phobius details amino acids 220 to 245 (26 residues), see Phobius details amino acids 251 to 270 (20 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 103 to 304 (202 residues), 66.4 bits, see alignment E=1.4e-22

Best Hits

KEGG orthology group: None (inferred from 90% identity to sit:TM1040_3484)

Predicted SEED Role

"Glycerol-3-phosphate ABC transporter, permease protein UgpA (TC 3.A.1.1.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization (TC 3.A.1.1.3)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7DYE1 at UniProt or InterPro

Protein Sequence (315 amino acids)

>PGA1_c07410 binding protein dependent transport system permease (Phaeobacter inhibens DSM 17395)
MAEMNLAPETGSSATSPGASESWLRRNRQALAPWLFLAPGVIFFLFYVIFPILQSFNLSF
YRWDGLGDPQFIGMENYRELMDDRAFEVSLWNNLKWLLLYLLAIPAGLFIALFLNQTVTG
IRLYKSLFFFPFVISQVVVGLVFSWFYDPTFGLLNQVLAWVGLGPINVLGDPTLVTYGII
IAGLWPQTAYCMILYLTGLNAVDPEQVEAARLDGAKGAKMLWYVIIPQLRPATFVAFVVT
IIGALRSFDLISIMTNGGPFGSSRVLSFYMFEKALSEYGFRMGYGAAIAVVLFLIMLCFI
AYFLWSMYQDDKGGR