Protein Info for PGA1_c07400 in Phaeobacter inhibens DSM 17395

Annotation: binding protein dependent transport system permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 282 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 78 to 104 (27 residues), see Phobius details amino acids 111 to 129 (19 residues), see Phobius details amino acids 149 to 168 (20 residues), see Phobius details amino acids 189 to 214 (26 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details PF00528: BPD_transp_1" amino acids 98 to 272 (175 residues), 60.5 bits, see alignment E=9.2e-21

Best Hits

KEGG orthology group: None (inferred from 93% identity to sit:TM1040_3485)

Predicted SEED Role

"Multiple sugar ABC transporter, membrane-spanning permease protein MsmG" in subsystem Fructooligosaccharides(FOS) and Raffinose Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJU8 at UniProt or InterPro

Protein Sequence (282 amino acids)

>PGA1_c07400 binding protein dependent transport system permease (Phaeobacter inhibens DSM 17395)
MFPKPIQNSSRAWQTTYQALVPAALVMWLLPLIAVAIFSIKPEADFTTGNYWGVPSSFEG
LSNYGRVFFGSDMPRYLLNSVLITVPTVIGAVALSCMTGFALGVYKFRGNLLLFFMFVAG
NFVPFQILMVPVRDLTLDMGLYNTKTGLVLFHIAFQTGFCTLFMRNFIRALPFELIEAAR
VEGVAEWRIFWFVVLPLMKPAIAALSVLIFTFIWNDYFWAVVLTQGAESQPVTAGITSFN
AQYRAAYHLMSAGSIVAALPPVAMFFLMQRHFIAGLTLGAVK