Protein Info for Psest_0727 in Pseudomonas stutzeri RCH2

Annotation: Methyl-accepting chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 676 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 322 to 345 (24 residues), see Phobius details PF00672: HAMP" amino acids 350 to 395 (46 residues), 35.7 bits, see alignment 9e-13 PF00015: MCPsignal" amino acids 487 to 641 (155 residues), 140.3 bits, see alignment E=5.9e-45

Best Hits

KEGG orthology group: K03406, methyl-accepting chemotaxis protein (inferred from 92% identity to psa:PST_3624)

Predicted SEED Role

"Methyl-accepting chemotaxis protein I (serine chemoreceptor protein)" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIT4 at UniProt or InterPro

Protein Sequence (676 amino acids)

>Psest_0727 Methyl-accepting chemotaxis protein (Pseudomonas stutzeri RCH2)
MNSLLYPAIAFMNRLSFGMKFSLVSVLFFVPMLLSNYYLVRDSYRAFVGTRTELQSLELL
GSTLQVRRSMEDWKDLVRIESIIGQTGNVEALQTRLNRVEGELAAQLQALAPVGDAPEQV
AEFNARRDELVAGLNAAQAEQSLQSKAAMAETLLGQSQVMIKLVAGQSGLSQDLEREVRL
LAELLTTVTPAISATLGEGRAVGSYTFGQGYLNSDASNTLDNLVLELEKQQAQYAAQLQD
ALGASAAARRKLESFATASRESLQASSDILQDEVIMADALDRPWEQFYERISAEMAKTYQ
LNDAILGFLEVELAERLEQKRLLMTLLISAVAIVLVLVAYLYAGFYASTRASLRSLGKIM
DKVAAGDMTARYQVQSRDELGELGQVFNTTVAQVRELIERVGQTVAEVDRQAQRVESVSG
ESNQTVSEQRGQIEQVATAMNEMSATAQEVASSAEAAVGSAQSVNEETVSGRALVVAQVG
GIQRLASEIEQSVQVINQLAGDSKAISQVLDVIKTIAEQTNLLALNAAIEAARAGEQGRG
FAVVADEVRGLAQRTQKSTAEIEQMIARLQNGVGAAVKTMHASHALAEDTVGQSGQVEQA
LENILGAVGLIVDQNQQIAAAAEQQTAVAHDIDRNIVAINEAGQRTAEGAGHTEQASREL
SQLVGRLQQLISAFRV