Protein Info for PGA1_c00730 in Phaeobacter inhibens DSM 17395

Annotation: ATP synthase B' chain

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02326: YMF19
  • amino acids 23 to 97 (75 residues), 43.9 bits, E=3.7e-15
• PF00430: ATP-synt_B
  • amino acids 34 to 160 (127 residues), 62.5 bits, E=4.6e-21

Best Hits

Swiss-Prot: 81% identical to ATPF2_RUEST: ATP synthase subunit b 2 (atpF2) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K02109, F-type H+-transporting ATPase subunit b [EC: 3.6.3.14] (inferred from 81% identity to sit:TM1040_2592)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Oxidative phosphorylation
• Photosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.14

Use Curated BLAST to search for 3.6.3.14

Sequence Analysis Tools

See I7DWK9 at UniProt or InterPro

Protein Sequence (181 amino acids)

>PGA1_c00730 ATP synthase B' chain (Phaeobacter inhibens DSM 17395)
MATQTQDAGHGAAEAAHGSGGMPQLDFSTYANQIFWLVVTLVVIYFILSRIALPRIAAVL
AERQGTITNDLAAAEDLKAKAVEAETAYNQALADARAEAQRIAAETRAEIQADLDEAIAK
ADAQIAAKAAESEAVIAEIKAGAIASVEAVAVDTAAEIVATFGGKADEKAVAAAVADRMK
G