Protein Info for PGA1_c07240 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92)
Rationale: Specifically important for utilizing m-Inositol. Automated validation from mutant phenotype: the predicted function (2.7.1.92) was linked to the condition via a SEED subsystem. This annotation was also checked manually.
Original annotation: putative 5-dehydro-2-deoxygluconokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 330 TIGR04382: 5-dehydro-2-deoxygluconokinase" amino acids 15 to 321 (307 residues), 326.6 bits, see alignment E=7.9e-102 PF00294: PfkB" amino acids 17 to 313 (297 residues), 169.5 bits, see alignment E=5.7e-54

Best Hits

KEGG orthology group: K03338, 5-dehydro-2-deoxygluconokinase [EC: 2.7.1.92] (inferred from 81% identity to dsh:Dshi_1268)

Predicted SEED Role

"5-keto-2-deoxygluconokinase (EC 2.7.1.92)" in subsystem Inositol catabolism (EC 2.7.1.92)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.92

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUR0 at UniProt or InterPro

Protein Sequence (330 amino acids)

>PGA1_c07240 5-dehydro-2-deoxygluconokinase (EC 2.7.1.92) (Phaeobacter inhibens DSM 17395)
MGQPSKARSDLAGRNFLVIGRVGMDLCPTPAGTATADAQDMMVAMGGSSANIAAGLVKMG
CRSALVTSVSDDAVGWYCLNQLDHYGVDRTHVKRITGEYRTSLAVYESRVEDHQSVIYRN
NAADFQMTIADVEAVDYSQYSALITAGTVFAAEPSRSATFRAFDLARAAGLPIIFDVDYR
PYSWPSPEVAADVLSRAGAMSDIIVGNDEEFGFMAGGIDKGRAKARALAETSASVVVYKM
GPKGAVTFADGQEIRTGIYPVDALKPTGAGDSFMAGFLASLSEGRPMKDAILRGSACASV
VVAKPGCAPAMPDLAALEAFLATHPGATEL