Protein Info for PGA1_c07220 in Phaeobacter inhibens DSM 17395

Updated annotation (from data): 5-keto-2-deoxy-D-gluconate-6 phosphate aldolase (EC 4.1.2.29)
Rationale: Specifically important for: m-Inositol. Part of inositol catabolism via 5-deoxyglucuronate (SEED_correct)
Original annotation: putative 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01116: F_bP_aldolase
  • amino acids 5 to 274 (270 residues), 242.5 bits, E=3.2e-76

Best Hits

KEGG orthology group: K01624, fructose-bisphosphate aldolase, class II [EC: 4.1.2.13] (inferred from 84% identity to sit:TM1040_3351)

Predicted SEED Role

"5-keto-2-deoxy-D-gluconate-6 phosphate aldolase (EC 4.1.2.29)" in subsystem Inositol catabolism (EC 4.1.2.29)

MetaCyc Pathways

• gluconeogenesis I (12/13 steps found)
• myo-inositol degradation I (7/7 steps found)
• superpathway of glycolysis and the Entner-Doudoroff pathway (14/17 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (10/12 steps found)
• photosynthetic 3-hydroxybutanoate biosynthesis (engineered) (20/26 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (20/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (17/22 steps found)
• glycolysis II (from fructose 6-phosphate) (9/11 steps found)
• glycolysis III (from glucose) (9/11 steps found)
• pentose phosphate pathway (non-oxidative branch) II (5/6 steps found)
• Calvin-Benson-Bassham cycle (10/13 steps found)
• glycolysis I (from glucose 6-phosphate) (10/13 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• gluconeogenesis III (9/12 steps found)
• homolactic fermentation (9/12 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• myo-, chiro- and scyllo-inositol degradation (7/10 steps found)
• glycolysis IV (7/10 steps found)
• glycolysis V (Pyrococcus) (7/10 steps found)
• 1-butanol autotrophic biosynthesis (engineered) (19/27 steps found)
• sedoheptulose bisphosphate bypass (1/2 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)
• superpathway of N-acetylneuraminate degradation (15/22 steps found)
• glycolysis VI (from fructose) (7/11 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)
• oxygenic photosynthesis (11/17 steps found)
• sucrose degradation V (sucrose α-glucosidase) (2/5 steps found)
• superpathway of hexitol degradation (bacteria) (11/18 steps found)
• 1,3-propanediol biosynthesis (engineered) (4/9 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (21/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Carbon fixation in photosynthetic organisms
• Fructose and mannose metabolism
• Glycolysis / Gluconeogenesis
• Inositol phosphate metabolism
• Pentose phosphate pathway

Isozymes

Compare fitness of predicted isozymes for: 4.1.2.13

Use Curated BLAST to search for 4.1.2.13 or 4.1.2.29

Sequence Analysis Tools

See I7EX64 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PGA1_c07220 5-keto-2-deoxy-D-gluconate-6 phosphate aldolase (EC 4.1.2.29) (Phaeobacter inhibens DSM 17395)
MTIATLAEVLQPALRDGYAVAGLVTLGWEDMRAYVAAAEAEGVPVILQAGPSCRVHTPLP
ILGKMFRHLAEGASVPVVAHLDHGYTAEDCRIAIDSGFTSVMFDGSRNALDDNIAETAAI
AGMAHAAGVSCEGEIGFVGYSGGEGSAGTDPEEARRFAQETGVDAMAISVGNVHLQQDKE
GGLDIDRIRAIEAITEVPLVIHGGSGVPVAQRRMLARESRICKFNIGTELRMVFGAAMRD
AVNSDPDRFDRVSILSETHDPVVAAARSVLRAFKGETQC