Protein Info for PGA1_c07150 in Phaeobacter inhibens DSM 17395

Annotation: Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF02630: SCO1-SenC" amino acids 111 to 236 (126 residues), 48.5 bits, see alignment E=4.3e-17

Best Hits

Predicted SEED Role

"Cytochrome oxidase biogenesis protein Sco1/SenC/PrrC, putative copper metallochaperone" in subsystem Biogenesis of cytochrome c oxidases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJT0 at UniProt or InterPro

Protein Sequence (266 amino acids)

>PGA1_c07150 Uncharacterized protein SCO1/SenC/PrrC, involved in biogenesis of respiratory and photosynthetic systems (Phaeobacter inhibens DSM 17395)
MLPPQHPLADLNLPEDFHAQENSRRFHNRCCGVADRCCGPGRNLAPSGSDGAVDARCIAG
QSRSPLRRIPKRPGLPVQPAGTRIVPLNRLKPAPDGTVLTADGTTGQLHQLIDGKITLVS
FVYLTCGDVDGCPLAFSTLYDIHDASAQLPDLRQDVQLMTISFDPERDTVEAIAAFAHPV
SSDPASAQKLDWQVLTTPDTAALQPLLDGFGQVVDRGSADDQINHLLRMYLVDRHGMIRN
VYGLGLIDPRLLMTDVETLLLEEVGK