Protein Info for PGA1_c07090 in Phaeobacter inhibens DSM 17395

Annotation: large-conductance mechanosensitive channel

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 144 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 38 to 59 (22 residues), see Phobius details amino acids 79 to 104 (26 residues), see Phobius details TIGR00220: large conductance mechanosensitive channel protein" amino acids 1 to 143 (143 residues), 116 bits, see alignment E=6.5e-38 PF01741: MscL" amino acids 1 to 143 (143 residues), 146.7 bits, see alignment E=2.3e-47

Best Hits

Swiss-Prot: 78% identical to MSCL_RUEPO: Large-conductance mechanosensitive channel (mscL) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K03282, large conductance mechanosensitive channel (inferred from 78% identity to sil:SPO3495)

Predicted SEED Role

"Large-conductance mechanosensitive channel" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUP6 at UniProt or InterPro

Protein Sequence (144 amino acids)

>PGA1_c07090 large-conductance mechanosensitive channel (Phaeobacter inhibens DSM 17395)
MLQEFKDFIAKGNVMDMAVGIIIGAAFTAIVKSMVSDLINPIIGVFTGGVDFTNSYLVLA
GTVPEGASLEAAREAGAAVFAHGAFVMAVINFLIIAFVVFMLVRYVNRLKDAAFKQEDTA
PAEEAPAGPTELDVLLEIRDSLKR