Protein Info for Psest_0069 in Pseudomonas stutzeri RCH2

Annotation: UDP-glucose-4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 1 to 334 (334 residues), 454.3 bits, E=1e-140
• PF00106: adh_short
  • amino acids 2 to 112 (111 residues), 29.6 bits, E=2.4e-10
• PF05368: NmrA
  • amino acids 2 to 124 (123 residues), 27.9 bits, E=8.9e-10
• PF01370: Epimerase
  • amino acids 2 to 261 (260 residues), 188.3 bits, E=7.7e-59
• PF08659: KR
  • amino acids 2 to 129 (128 residues), 29.4 bits, E=3.6e-10
• PF02719: Polysacc_synt_2
  • amino acids 2 to 181 (180 residues), 51.3 bits, E=5.2e-17
• PF04321: RmlD_sub_bind
  • amino acids 2 to 160 (159 residues), 41.5 bits, E=4.7e-14
• PF16363: GDP_Man_Dehyd
  • amino acids 3 to 322 (320 residues), 184 bits, E=2.7e-57
• PF01073: 3Beta_HSD
  • amino acids 3 to 159 (157 residues), 60.8 bits, E=5.7e-20
• PF07993: NAD_binding_4
  • amino acids 4 to 164 (161 residues), 26.5 bits, E=1.8e-09
• PF13460: NAD_binding_10
  • amino acids 6 to 161 (156 residues), 30.2 bits, E=2e-10

Best Hits

Swiss-Prot: 60% identical to GALE_BACSU: UDP-glucose 4-epimerase (galE) from Bacillus subtilis (strain 168)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 94% identity to psa:PST_2892)

MetaCyc: 60% identical to UDP-glucose 4-epimerase (Bacillus subtilis subtilis 168)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (10/11 steps found)
• UDP-α-D-galactofuranose biosynthesis (2/2 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (1/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (1/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

See L0GFZ5 at UniProt or InterPro

Protein Sequence (354 amino acids)

>Psest_0069 UDP-glucose-4-epimerase (Pseudomonas stutzeri RCH2)
MILVTGGAGYIGSHAVLELLQAGHEVLVLDNLCNSSQLALDRVEQLAGRPLHFVKGDVRN
RALLKALFAAYPVTAVMHFAGLKAVGESVREPLRYYETNVGGSIALCQAMAEAGVFKLVF
SSSATVYGESPVMPITEDRPTGVPTNPYGQSKLMAENVLKGLADSDPRWSIGLLRYFNPI
GAHESGLIGEDPNGVPNNLLPYMLQVAVGRRKQLNVYGNDYPTLDGTGVRDYIHVVDLAK
GHLKALERLQLIHGVSTWNLGTGKGHSVREMITAFEEVTGRSLPHVIKPRRSGDIAQCWS
DPSKAERELGWRAEKDLTSMLADAWRWQSRNPRGYAADKVTAADLLSTQTALAS