Protein Info for HP15_671 in Marinobacter adhaerens HP15

Annotation: phage portal protein, lambda family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 525 PF05136: Phage_portal_2" amino acids 45 to 386 (342 residues), 290.8 bits, see alignment E=8.4e-91 TIGR01539: phage portal protein, lambda family" amino acids 51 to 494 (444 residues), 340.7 bits, see alignment E=5.9e-106

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPT4 at UniProt or InterPro

Protein Sequence (525 amino acids)

>HP15_671 phage portal protein, lambda family (Marinobacter adhaerens HP15)
MFEKWKRNKDQAQPATTEQTAPSGKMRTIRRALARSLLGQARADRLSADLPTTPVPADQF
IDKNQRALVARSRHLILTNDYARGFVRECRQNIVGRKGIQLQALSKDPDGSLDERANDAI
EADFHAWCDRLICDVAGRRSFRQLCSRAVEDAASNGEFMFRMVFGRNLNPWGLALQVLDP
QRCPVEVNEDRLPGGYFIRQGIKYNQWGRAVAYLFGTVDPAESDYQYGGRAFVEIPAEEV
LHGFKEDLVGQRRGLPWMLTALLRLHHLDGFEKAALVNARVSAAKGGFFEWEEGMGPSDE
EDDDEPLYMDAEPGSYQELPPGLKFNGWAPQFPNGELAAFSKQSLRGVATGFGLDYPTLA
NDLEGVNFSSLRHGVLSTRDHWMEDQEWLIEQLLEPLIRAWLPRALLKGITVPGTNGAVL
RADRIEKYREHDWQARRWDWVDPDKDSKTAARDIANKIKSPSQVIRERGGDPRTVWRQWA
ADRQAMIEAGIPEEIVDATLGGPVQTPTAGNTSEQEPTNGEAEQS