Protein Info for HP15_68 in Marinobacter adhaerens HP15

Annotation: sensory box/FOG: EAL domain/GGDEF domain containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1000 1100 1162 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 74 to 100 (27 residues), see Phobius details amino acids 106 to 126 (21 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 200 to 222 (23 residues), see Phobius details amino acids 438 to 456 (19 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 473 to 599 (127 residues), 47.5 bits, see alignment E=1.8e-16 amino acids 622 to 724 (103 residues), 69.2 bits, see alignment E=3.6e-23 PF13188: PAS_8" amino acids 475 to 518 (44 residues), 20.7 bits, see alignment (E = 1.1e-07) amino acids 607 to 661 (55 residues), 18.3 bits, see alignment 6.2e-07 PF00989: PAS" amino acids 476 to 590 (115 residues), 26 bits, see alignment E=2.9e-09 amino acids 607 to 715 (109 residues), 45.1 bits, see alignment E=3.3e-15 PF08448: PAS_4" amino acids 482 to 595 (114 residues), 45.8 bits, see alignment E=2.2e-15 amino acids 609 to 719 (111 residues), 39.4 bits, see alignment E=2.2e-13 PF13426: PAS_9" amino acids 613 to 717 (105 residues), 81.1 bits, see alignment E=2.3e-26 PF08447: PAS_3" amino acids 627 to 712 (86 residues), 30.9 bits, see alignment 9.5e-11 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 727 to 889 (163 residues), 157.8 bits, see alignment E=2.1e-50 PF00990: GGDEF" amino acids 729 to 885 (157 residues), 178.8 bits, see alignment E=2.5e-56 PF00563: EAL" amino acids 905 to 1140 (236 residues), 250.3 bits, see alignment E=6e-78

Best Hits

Predicted SEED Role

"diguanylate cyclase/phosphodiesterase (GGDEF & EAL domains) with PAS/PAC sensor(s)" in subsystem Bacterial hemoglobins

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PIC7 at UniProt or InterPro

Protein Sequence (1162 amino acids)

>HP15_68 sensory box/FOG: EAL domain/GGDEF domain containing protein (Marinobacter adhaerens HP15)
MTEQTSSLSRQAVLLLLLLSCIAIGAKILLLEFMKIDLVPVSQDLTLAEAVGLILAGFTL
GVMVLGVSKPVRLVFSAVLLIYSLSSLVQSVNIFGVSGLFSIKVGLLPLMPAAIATLAGI
CCALGLTRRTLILWRLFGSIAGTVGILAILQGLGVSSFPSILQIPADQASFTGALFAIAI
GVIAWMLARSIDRPAISLPYSAIGIGISGTLATVILMCVASIDRHEERLKAANGVLENLT
HAIEQASENRMRVLQRMAERWALLSEYVGDEIYKTDARLLTQDKLGFLAYALIGVSGWRY
ASVPSTGQWLEEQLDKPESSRWLREFRAGEEPGSWFFPSDDYPSRAFLVVRPPNNSKYIL
IGLVDLREFIQAETRQAADELVINVSRSGIPLTSIAGAIGAAGKKGEVYAESQAQLPGNG
QPLIARALPRFDAIDNQLPVAIFFFGLMFTHQLILSRSLSHIRHEQSKTLALSEQRFRSL
YDHNPDAVFSLDADGRYRDINPATKHSLGVPNCELRGRHFTERINKETVPEGDLKEVFRA
YTEATRGYPRTDFSMSLRTSGHEVRHFDVTFLPIVIQDRIDGVFAIAKDITKRVRTEEQQ
RIMQRSVEASSNAVVITNARDPGFPVVYVNPAFSQITGFGSEEVEGQSLGFLIGEGSEDD
DIERIKVAVREHRSVSVTMRSYRKDGAPFWYQLFLSPVRDDEGEVTHFVAVINDISEKKE
QDEEMAYQATHDLLTGLANRSLFNDRLKHDFELAKRHSQSMAVLFIDLDEFKPINDTLGH
RVGDKLLVSVAERLNSLIRPSDTLARFGGDEFVLLLPDLEETGLAEEIAERILQELAKPH
QIDNNELHISASIGIATNSHSSRFPEKLLQRADMAMYKAKQQGRDTYEIYSADLDEALST
RVTLRNDLQEAIKGDQLRLHYQPLVNADGSIVSLEALVRWQHPQKGSISPADFIPIAEET
GQIVPLGKWVTRKACEDALILIERGLRMGCMAVNLSPMQFHRPNFLNVLRQILEETGLPP
EYLELELTEGILMKDTGGAKNILNDLRGMGVKTAIDDFGTGFSSFGYLRELPVDKIKIDR
SFVEDVTSCEKDAAVCKGVITLARELGMRVVAEGVETEEQYRYLAKHGCTGFQGYYFAKP
MALDELIVWVEENAGGLRWQRL