Protein Info for HP15_654 in Marinobacter adhaerens HP15

Annotation: major tail sheath protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 505 PF22671: Gp18_domIII_N" amino acids 148 to 200 (53 residues), 27.9 bits, see alignment 3.7e-10 PF04984: Phage_sheath_1" amino acids 223 to 392 (170 residues), 79.4 bits, see alignment E=4.3e-26 PF17482: Phage_sheath_1C" amino acids 395 to 492 (98 residues), 68.5 bits, see alignment E=7.1e-23

Best Hits

Predicted SEED Role

"Phage tail sheath monomer"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPR7 at UniProt or InterPro

Protein Sequence (505 amino acids)

>HP15_654 major tail sheath protein (Marinobacter adhaerens HP15)
MAKFLHGVEVLEIDTGPRPIQTVRSGVIGIVGTAPEAEGATAATLTIGNAPANTGILFTA
VAGGTDGNNTRIRLVDPGTASASLTFTVDGNDITASLATDVDSNITTTAADLITGINGDA
NASALVTAAAVDGSDGTGVLQARAYESLSGGAAEPFPLNTPVLVAGSRGEAARLGTTGTL
PDAMDGIFDQVGAVVIVIRVEEGQDDPETTANVVGGVNATTGNLEGVHALLGAESVVGFS
PRILCAPGYTHQRESGQRNAVVAELLGIAERLRAVIVADGPNTTDDAAQQYANDFGSSRV
YLVDPWPTVLQSDGSYAAEPGSGRVAGVIAKIDNDQGFWWSPSNKPINGIVGTARPVDFK
LGDANSRANLLNEGGIATIIRQDGYRLWGNRSLTDDTKWIFLSVRRTADMINDSIQRAHL
WAVDRNITKTYVEDVTDGVNAYIASLVAQGALLGGRCWPDPDLNTPENIQLGKVYFNFEF
TPPYPAEHITFRSMLVNDYVTEVFE