Protein Info for Psest_0672 in Pseudomonas stutzeri RCH2

Annotation: Alcohol dehydrogenase, class IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 382 PF00465: Fe-ADH" amino acids 11 to 176 (166 residues), 168 bits, see alignment E=2.3e-53 PF13685: Fe-ADH_2" amino acids 16 to 107 (92 residues), 40.6 bits, see alignment E=3.9e-14 PF25137: ADH_Fe_C" amino acids 187 to 381 (195 residues), 261.1 bits, see alignment E=8.9e-82

Best Hits

Swiss-Prot: 68% identical to ADH2_ZYMMO: Alcohol dehydrogenase 2 (adhB) from Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4)

KEGG orthology group: K13954, alcohol dehydrogenase [EC: 1.1.1.1] (inferred from 83% identity to avn:Avin_07980)

MetaCyc: 68% identical to alcohol dehydrogenase II monomer (Zymomonas mobilis)
Alcohol dehydrogenase. [EC: 1.1.1.1]

Predicted SEED Role

"Alcohol dehydrogenase (EC 1.1.1.1)" in subsystem Fermentations: Mixed acid or Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 1.1.1.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.1

Use Curated BLAST to search for 1.1.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIN5 at UniProt or InterPro

Protein Sequence (382 amino acids)

>Psest_0672 Alcohol dehydrogenase, class IV (Pseudomonas stutzeri RCH2)
MSSTFFIPAVNMMGIGSLDEAMVAIANYGFRKALIVTDVGLARAGVAEKVATLLAAADIQ
SVVFDGAQPNPTVGNVEKGLSQLRESACDFIISLGGGSPHDCAKGIALCATNGGHIADYE
GVDRSAKPQLPLVAINTTAGTASEMTRFCIITDESRHVKMAIVDRNVTPLLSVNDPALMV
AMPKGLTAATGMDALTHAVEAYVSTAATPITDACALKAIELISANLRTAVASGSDMPARE
AMAYAQFLAGMAFNNASLGYVHAMAHQLGGFYDLPHGVCNAVLLPHVESYNASVCPERLR
DIATAMGVETRGLDATQGAEAALAAIRTLSQDIGIPGGLAELGAKADDIPTLAANAMNDA
CGLTNPRRATQEEIEAIFHSAL