Protein Info for HP15_638 in Marinobacter adhaerens HP15

Annotation: integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 828 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 261 to 280 (20 residues), see Phobius details amino acids 286 to 307 (22 residues), see Phobius details amino acids 314 to 335 (22 residues), see Phobius details amino acids 363 to 383 (21 residues), see Phobius details amino acids 389 to 415 (27 residues), see Phobius details amino acids 444 to 463 (20 residues), see Phobius details amino acids 670 to 688 (19 residues), see Phobius details amino acids 694 to 716 (23 residues), see Phobius details amino acids 721 to 742 (22 residues), see Phobius details amino acids 769 to 787 (19 residues), see Phobius details amino acids 793 to 814 (22 residues), see Phobius details PF03176: MMPL" amino acids 220 to 415 (196 residues), 67.3 bits, see alignment E=1.8e-22 amino acids 600 to 821 (222 residues), 51.7 bits, see alignment E=9.8e-18

Best Hits

KEGG orthology group: K07003, (no description) (inferred from 83% identity to maq:Maqu_2375)

Predicted SEED Role

"Probable integral membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PPQ1 at UniProt or InterPro

Protein Sequence (828 amino acids)

>HP15_638 integral membrane protein (Marinobacter adhaerens HP15)
MNRLRALYDRLIFPHPVIILAGFGLLLAIAAIKFGEFRLDASAESLVLENDRSLEQYRQV
NRRFTTSDDFLIVTYTPEGELFSEDGLARLGALRDELQGLESVGSTNSILNVPLLHSPDL
TLDTVDSEIKTLDDHDVTPDTARQALLNNPLYPNLLISEDGRTTAIQVNLPTPDRYFELL
RKRNDLRDKADAGKASEAELAELEQVKQDFIDFTETLGVERDATIRTVRSILDTYRDGAD
IHLGGVPMIVADMIRFIENDLSTFGLGVLAFLLLTLAIIFRQWRWVLVPLLCCSFTVWLM
VGFLGWAQWPVTVISSNFISLLLIMTLSLTIHLIVRYREFQHDEPEASPKDTLRNTVMAM
IKPCFYMAITTIVAFGSLTFSGIRPVIDFGWMMTLGLTVAFLITFIVFPALLTLLPPPLD
SRVTSDRVPFTDAFARFTEHFGKTVLVGSGLIAVLCVVGLNKLTVENSFIDYFKSSTEIH
QGMITIDNRLGGTTPLDVVITDDPPPEGASGGDPFASDCDPFVEDCGAGEEYRDTWYTYQ
KMEQLEAVHDYLDGLPETGKVLSINTTLDILAQINQGEPLDALELAFVPAAVPDDLQDTL
LTPYISEEHDQARFSIRILETMPELRRQELLNRIHEHLTTELGYSKDQVLFAGMTVMYNN
MLQSLFDSQIKTIGVVFAAIMLMFLILFRSLKLALIGIAPNLIAAGSVLGLMGWLGIPLD
MMTITVAAITVGIAVDDTIHYIHRFKTEFQKDGDYIATMHRCHRSIGQAMFFTSLTIISG
FSILVLSNFIPTIYFGLFTGFAMFMALVGALTLLPRLIVLVKPFGSGV