Protein Info for Psest_0666 in Pseudomonas stutzeri RCH2

Annotation: Uncharacterized protein conserved in bacteria

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 270 PF06167: Peptidase_M90" amino acids 5 to 249 (245 residues), 295.6 bits, see alignment E=1.5e-92

Best Hits

Swiss-Prot: 44% identical to MTFA_YERE8: Protein MtfA (mtfA) from Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081)

KEGG orthology group: K09933, hypothetical protein (inferred from 90% identity to psa:PST_3685)

MetaCyc: 43% identical to Mlc titration factor (Escherichia coli K-12 substr. MG1655)
3.4.11.-

Predicted SEED Role

"Inner membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GIX3 at UniProt or InterPro

Protein Sequence (270 amino acids)

>Psest_0666 Uncharacterized protein conserved in bacteria (Pseudomonas stutzeri RCH2)
MWSYRAWQRKRILARNPVSPELWQQVLDSLPILDGLSEDELSRLRERAVLFLHEKRLTPL
AGVELQPQDRLRLALQAQLPLLHLAELGWYRGFHEIVIYPDDFLSPQKHRDAAGVEHEWD
AEHSGEAWLQGPVILAWPGVQESGGWEAYNLVIHELAHKLDMLNGDANGLPPLHRQMRIE
AWASAMQSAYDQLDRLLDANPDAETPIDPYAAENPAEFFAVTSEYFFSAPDVLHQIFPEV
YAQLADFYRQDPLTRLQRLQAEHPAYREPA