Protein Info for Psest_0663 in Pseudomonas stutzeri RCH2

Annotation: PAS fold.

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 599 transmembrane" amino acids 33 to 51 (19 residues), see Phobius details amino acids 59 to 81 (23 residues), see Phobius details PF08448: PAS_4" amino acids 110 to 214 (105 residues), 44.7 bits, see alignment E=2.1e-15 amino acids 230 to 328 (99 residues), 36.1 bits, see alignment E=9.9e-13 PF13188: PAS_8" amino acids 226 to 277 (52 residues), 17.5 bits, see alignment 4.6e-07

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GGW7 at UniProt or InterPro

Protein Sequence (599 amino acids)

>Psest_0663 PAS fold. (Pseudomonas stutzeri RCH2)
MHPHSADVFVDAYLARHAGPSVASPRPAWQKPWLLALLAAAISLLAGVLWRSLDLPAGPA
LVLPGIAVAGALPVYLCARLLHQRKRLTHARGEVALLRQLCSLWAQSEGACLKELDAHGR
LLAMSERGRQLMDVCDFDALRGSDWLGIWPGEAAATARDAFARALAGEPARFSGFCPTLA
GVAKWWDVLIMPLPGAGEATSMLVLSWDVTEVRQRACQLQTTNDELTTLLEHLDDGFCRL
DRSWRLVELNGRAVALLQRPRSELLGTLLWDLLPQARGAELGVALQEVMDLGIARRIETF
SPQYQGWYRIHAYPHADGLYLFFSDISRDVASAQTAQAVQARLRLSQQVGLFGDWQFDLT
SQRLDLSDQALQLLGMPSGAAAGEALLERLHPQDRLGFVAAMLDLAEGQTGFDARVRLSG
TAAEDWRHFHFAGTVIRTKAHPAGLLVGCLQDVTEQQRREARLEDAEAFTRGIIDALPLA
IGVIDGNGRLITANQVWMAGGNAPAALSGCKSLDYLARCRAATGDGFDAGARLADGIEAL
LAGTGDPFVFSYEHGSDAQRRVYQSSALLMSTLTRRVLVVHELLTGESRNSEGAALTPA