Protein Info for HP15_630 in Marinobacter adhaerens HP15

Annotation: alanine racemase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00492: alanine racemase
  • amino acids 4 to 357 (354 residues), 344.3 bits, E=3.7e-107
• PF01168: Ala_racemase_N
  • amino acids 9 to 220 (212 residues), 202.9 bits, E=5.6e-64
• PF00842: Ala_racemase_C
  • amino acids 234 to 357 (124 residues), 150.6 bits, E=1.8e-48

Best Hits

Swiss-Prot: 68% identical to ALR_MARHV: Alanine racemase (alr) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K01775, alanine racemase [EC: 5.1.1.1] (inferred from 68% identity to maq:Maqu_2381)

Predicted SEED Role

"Alanine racemase (EC 5.1.1.1)" in subsystem Alanine biosynthesis or Pyruvate Alanine Serine Interconversions (EC 5.1.1.1)

MetaCyc Pathways

• alanine racemization (1/1 steps found)
• L-alanine degradation I (1/2 steps found)
• anaerobic energy metabolism (invertebrates, cytosol) (4/7 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (8/17 steps found)
• ansatrienin biosynthesis (1/9 steps found)
• cyclosporin A biosynthesis (2/15 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• D-Alanine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.1.1.1

Sequence Analysis Tools

See E4PP82 at UniProt or InterPro

Protein Sequence (358 amino acids)

>HP15_630 alanine racemase (Marinobacter adhaerens HP15)
MPRSTIARIDLDALRRNFQTAQRRAGGARVMAVVKADGYGHGIGPVASALDSLAPKYAVA
CLEEARAIRETGLIQSVVLLQGVHAEADIDECARSGFEPVFHSFQQLAWLERLDTWPAFW
LKVNSGMNRLGFHPDELAGVMSRLQAMSADTELLGFVTHFACADDPDSAMTAQQTAVFEK
ATSSFPDLMKSVANSAAHFRPGQPMFDWSRPGIMLYGGSPMVGTTGPELGLEPVMSLEAP
LISTRMVPAGESVGYGASWVADRDTRMGMVAIGYGDGYPRHAGTNTPAAINGQRIRLIGR
VSMDMLAVDLTNAPDAKEGDSVELWGRTVGVDEVAACAGTISYELMTGITGRVPRQYR