Protein Info for PGA1_c06550 in Phaeobacter inhibens DSM 17395

Annotation: phosphoglucosamine mutase GlmM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 448 PF02878: PGM_PMM_I" amino acids 3 to 136 (134 residues), 152.5 bits, see alignment E=1.1e-48 TIGR01455: phosphoglucosamine mutase" amino acids 5 to 443 (439 residues), 597.3 bits, see alignment E=8.3e-184 PF02879: PGM_PMM_II" amino acids 158 to 254 (97 residues), 59.3 bits, see alignment E=1e-19 PF02880: PGM_PMM_III" amino acids 258 to 366 (109 residues), 123.2 bits, see alignment E=1.2e-39 PF00408: PGM_PMM_IV" amino acids 374 to 439 (66 residues), 52.7 bits, see alignment E=7.3e-18

Best Hits

Swiss-Prot: 86% identical to GLMM_RUEST: Phosphoglucosamine mutase (glmM) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 86% identity to sit:TM1040_2305)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EX08 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PGA1_c06550 phosphoglucosamine mutase GlmM (Phaeobacter inhibens DSM 17395)
MRKFFGTDGVRGTANIHPMTADMALRIGAAVGRYFRRDASGVHRVVIGKDTRLSGYMFES
ALTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAADNGIKFFGPDGFK
LSDTVEMELEALIEAGVEPAQAQNIGRAKRIDDARFRYGERVKSSLPRDIRLDGLKVVID
CANGAAHRAAPEILWELGAEVIPVGVSPDGTNINRDCGSTHPGTAAETVVAHGAHVGICL
DGDADRVIIIDDTGKVADGDQLMALLATRWAEDGVLAGNALVSTVMSNLGLERHLAARGI
ALERTAVGDRYVVERMREGGFNLGGEQSGHIVMTDYATTGDGLMAGLHFLAEMVRADKPA
SQLAQQFAPVPQLLKNVRFAAGQTPLESDQVQTAIRVAEETLAGQGRLLIRKSGTEPLVR
VMAECEDAKVLTAAVDSVVAAVEAAVAE