Protein Info for PGA1_c06550 in Phaeobacter inhibens DSM 17395

Annotation: phosphoglucosamine mutase GlmM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02878: PGM_PMM_I
  • amino acids 3 to 136 (134 residues), 152.4 bits, E=1.3e-48
• TIGR01455: phosphoglucosamine mutase
  • amino acids 5 to 443 (439 residues), 597.3 bits, E=8.3e-184
• PF02879: PGM_PMM_II
  • amino acids 158 to 254 (97 residues), 61.9 bits, E=1.5e-20
• PF02880: PGM_PMM_III
  • amino acids 258 to 366 (109 residues), 123 bits, E=1.4e-39
• PF00408: PGM_PMM_IV
  • amino acids 374 to 442 (69 residues), 53.4 bits, E=4.4e-18

Best Hits

Swiss-Prot: 86% identical to GLMM_RUEST: Phosphoglucosamine mutase (glmM) from Ruegeria sp. (strain TM1040)

KEGG orthology group: K03431, phosphoglucosamine mutase [EC: 5.4.2.10] (inferred from 86% identity to sit:TM1040_2305)

Predicted SEED Role

"Phosphoglucosamine mutase (EC 5.4.2.10)" in subsystem Sialic Acid Metabolism or UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis (EC 5.4.2.10)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• UDP-N-acetyl-D-glucosamine biosynthesis I (5/5 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• colanic acid building blocks biosynthesis (9/11 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (5/6 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• sucrose degradation II (sucrose synthase) (4/5 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• sucrose degradation IV (sucrose phosphorylase) (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• D-galactose degradation I (Leloir pathway) (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• chitin biosynthesis (5/9 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• sucrose biosynthesis II (4/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (1/4 steps found)
• starch degradation III (1/4 steps found)
• starch degradation V (1/4 steps found)
• peptidoglycan recycling I (8/14 steps found)
• glycogen degradation II (2/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (1/5 steps found)
• glycogen degradation I (3/8 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (1/8 steps found)
• CMP-legionaminate biosynthesis I (2/10 steps found)
• starch biosynthesis (2/10 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (7/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (14/33 steps found)
• streptomycin biosynthesis (2/18 steps found)
• superpathway of UDP-N-acetylglucosamine-derived O-antigen building blocks biosynthesis (6/24 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.10

Use Curated BLAST to search for 5.4.2.10

Sequence Analysis Tools

See I7EX08 at UniProt or InterPro

Protein Sequence (448 amino acids)

>PGA1_c06550 phosphoglucosamine mutase GlmM (Phaeobacter inhibens DSM 17395)
MRKFFGTDGVRGTANIHPMTADMALRIGAAVGRYFRRDASGVHRVVIGKDTRLSGYMFES
ALTAGLTSTGMNVLLLGPVPTPAVGLMTRSMRADLGVMISASHNPAADNGIKFFGPDGFK
LSDTVEMELEALIEAGVEPAQAQNIGRAKRIDDARFRYGERVKSSLPRDIRLDGLKVVID
CANGAAHRAAPEILWELGAEVIPVGVSPDGTNINRDCGSTHPGTAAETVVAHGAHVGICL
DGDADRVIIIDDTGKVADGDQLMALLATRWAEDGVLAGNALVSTVMSNLGLERHLAARGI
ALERTAVGDRYVVERMREGGFNLGGEQSGHIVMTDYATTGDGLMAGLHFLAEMVRADKPA
SQLAQQFAPVPQLLKNVRFAAGQTPLESDQVQTAIRVAEETLAGQGRLLIRKSGTEPLVR
VMAECEDAKVLTAAVDSVVAAVEAAVAE