Protein Info for HP15_622 in Marinobacter adhaerens HP15

Annotation: exoribonuclease R

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 813 TIGR02063: ribonuclease R" amino acids 3 to 697 (695 residues), 841.3 bits, see alignment E=6.2e-257 TIGR00358: VacB and RNase II family 3'-5' exoribonucleases" amino acids 41 to 697 (657 residues), 751.3 bits, see alignment E=8.8e-230 PF08206: OB_RNB" amino acids 48 to 105 (58 residues), 74.5 bits, see alignment 8.7e-25 PF17876: CSD2" amino acids 125 to 199 (75 residues), 92.7 bits, see alignment E=2.4e-30 PF00773: RNB" amino acids 221 to 553 (333 residues), 376.2 bits, see alignment E=3.1e-116 PF00575: S1" amino acids 614 to 695 (82 residues), 43.9 bits, see alignment E=5.2e-15

Best Hits

KEGG orthology group: K12573, ribonuclease R [EC: 3.1.-.-] (inferred from 83% identity to maq:Maqu_2388)

Predicted SEED Role

"3'-to-5' exoribonuclease RNase R" in subsystem RNA processing and degradation, bacterial

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PP74 at UniProt or InterPro

Protein Sequence (813 amino acids)

>HP15_622 exoribonuclease R (Marinobacter adhaerens HP15)
MCSELGQSSEEGIEALRRRLIAMCRDGQLICNRRGAYLPIEEADLVTGRVIGHKDGFGFL
VPDDGGSDLFLTARQMRQVFHGDRVAARVDRVDDRGRREGVIVEVLEYRTSQTVGRFFQE
SGISFVVPENARINHEVLIPQENCGNARHGQYVVVDIVRQPTVRTQPLGKVVEVLGEHMA
PGMEIDVAIRSYDIPHSWPPAVGEQTAAIPEEVTEKDKVNRKDIRNLRLVTIDDETARDF
DDAVYCEPRARGGYRLLVAIADVSHYVRPGTPLDEEAVNRSTSVYFPDHVVPMLPEKLSN
GLCSLNPGVDRLCMVADMTISAAGNISSYSFYQAVMFSHARLTYNKVSTMLEHPDTEQGY
KLCEQYANVLPQLHNLYGLYQLLRKARTERGAIDFETTETKIVFDADRKIEEIVPVQRND
AHKIIEECMLCANVATARFLKKHKLPALYRVHDGPSEERLNAVRLFLGELGLQLGGGDSP
TSADYQELLNSIKDRSDANVIQTVMLRSLSQAVYSPEEGGHFGLGYAGYAHFTSPIRRYP
DLINHRAIKSVIHGGQPSKDVVPPPKPDPELAEYPYDMARMEQLGEHTSMAERRADDATR
DVMAWLKCEYLSDHVGEEYDGVIASVVPFGFFVELSGVYIEGLVHVSTLSGDFFHHDSAK
HRLIGERTAMSFRLGDEVRVKVVRVGMEDRKIDLELISEPVHRQADRDALKVPDKGERGK
GKRGPGKGGKPPGRTKPGQKSASPGEPGLKRPRKRPASASSKKKGPEAFDDNETPSARDE
LVAKAAKLALKKGKKGSGAGKDDKKAKPRKSGK