Protein Info for PGA1_c06530 in Phaeobacter inhibens DSM 17395

Annotation: dihydroneopterin aldolase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00526: FolB domain
  • amino acids 26 to 124 (99 residues), 48.7 bits, E=4.1e-17
• PF02152: FolB
  • amino acids 28 to 134 (107 residues), 67.8 bits, E=6.2e-23

Best Hits

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 84% identity to sit:TM1040_2307)

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25) / delta 1-pyrroline-5-carboxylate synthetase" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

• superpathway of tetrahydrofolate biosynthesis and salvage (10/12 steps found)
• superpathway of tetrahydrofolate biosynthesis (8/10 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis I (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis III (Chlamydia) (3/5 steps found)
• 6-hydroxymethyl-dihydropterin diphosphate biosynthesis II (Methanocaldococcus) (2/7 steps found)
• superpathway of chorismate metabolism (36/59 steps found)
• tetrahydromethanopterin biosynthesis (2/14 steps found)

KEGG Metabolic Maps

• Folate biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25

Sequence Analysis Tools

See I7EJN1 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PGA1_c06530 dihydroneopterin aldolase-like protein (Phaeobacter inhibens DSM 17395)
MSSEIRLAFAHPSERSEATASRGPLDRISLRDHTVEVEIGAFQAERGTTQRICFNVVVEI
APLPADLDDDVDRILSYDRVTEAIAHELSEERLNLLETLAERVAERILLEPQAVRAFVRI
EKLDRGPGALGVEIVRARDQVASEVDSGERPHPRLMYLSNSAIDSDGLTGWIDQMECRQR
PLILCVGAHELATPQTGHKWTQRRIDLLAIEQNAWRLAAKDDRCVVVSTRTELDWGMKNG
QICVWAPSKIVLDAVDGPSAAPSDAVALAAWFAATFEAGEMIVIGAALPDNPGVPLRAVD
VEQTQL