Protein Info for PGA1_c06530 in Phaeobacter inhibens DSM 17395

Annotation: dihydroneopterin aldolase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR00526: FolB domain" amino acids 26 to 124 (99 residues), 48.7 bits, see alignment E=4.1e-17 PF02152: FolB" amino acids 28 to 134 (107 residues), 67.8 bits, see alignment E=6.2e-23

Best Hits

KEGG orthology group: K01633, dihydroneopterin aldolase [EC: 4.1.2.25] (inferred from 84% identity to sit:TM1040_2307)

Predicted SEED Role

"Dihydroneopterin aldolase (EC 4.1.2.25) / delta 1-pyrroline-5-carboxylate synthetase" in subsystem Folate Biosynthesis (EC 4.1.2.25)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.1.2.25

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJN1 at UniProt or InterPro

Protein Sequence (306 amino acids)

>PGA1_c06530 dihydroneopterin aldolase-like protein (Phaeobacter inhibens DSM 17395)
MSSEIRLAFAHPSERSEATASRGPLDRISLRDHTVEVEIGAFQAERGTTQRICFNVVVEI
APLPADLDDDVDRILSYDRVTEAIAHELSEERLNLLETLAERVAERILLEPQAVRAFVRI
EKLDRGPGALGVEIVRARDQVASEVDSGERPHPRLMYLSNSAIDSDGLTGWIDQMECRQR
PLILCVGAHELATPQTGHKWTQRRIDLLAIEQNAWRLAAKDDRCVVVSTRTELDWGMKNG
QICVWAPSKIVLDAVDGPSAAPSDAVALAAWFAATFEAGEMIVIGAALPDNPGVPLRAVD
VEQTQL