Protein Info for PGA1_c06470 in Phaeobacter inhibens DSM 17395

Annotation: glycyl-tRNA synthetase alpha subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 309 TIGR00388: glycine--tRNA ligase, alpha subunit" amino acids 10 to 303 (294 residues), 450.9 bits, see alignment E=9.5e-140 PF02091: tRNA-synt_2e" amino acids 11 to 302 (292 residues), 467.9 bits, see alignment E=5.3e-145

Best Hits

Swiss-Prot: 82% identical to SYGA_PARDP: Glycine--tRNA ligase alpha subunit (glyQ) from Paracoccus denitrificans (strain Pd 1222)

KEGG orthology group: K01878, glycyl-tRNA synthetase alpha chain [EC: 6.1.1.14] (inferred from 93% identity to sit:TM1040_2312)

Predicted SEED Role

"Glycyl-tRNA synthetase alpha chain (EC 6.1.1.14)" (EC 6.1.1.14)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.1.1.14

Use Curated BLAST to search for 6.1.1.14

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EUJ6 at UniProt or InterPro

Protein Sequence (309 amino acids)

>PGA1_c06470 glycyl-tRNA synthetase alpha subunit (Phaeobacter inhibens DSM 17395)
MTDTKGAPRSFQEIILRLQNYWAAKGCAVMQPYDMEVGAGTFHPATTLRSLGSKAWAAAY
VQPSRRPTDGRYGENPNRLQHYYQYQVLIKPSPPNLQELYLGSLEAIGVDMDMHDIRFVE
DDWESPTLGAWGLGWEVWCDGMEVSQFTYFQQVGGHDCHPVSGELTYGLERLAMYILGVD
HVMDMPFNDPDAPIAMTYGDVFKQTEEEYARWNFDVANTEVLLRHFEEAEAECAAILAQA
HIDPKTGKRIIMAHPAYDQCIKASHVFNLLDARGVISVTERQAYIGRVRTLAKQCADAFV
QTEAGGHAA