Protein Info for Psest_0644 in Pseudomonas stutzeri RCH2

Annotation: siderophore ferric iron reductase, AHA_1954 family

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 TIGR03950: siderophore ferric iron reductase, AHA_1954 family" amino acids 21 to 238 (218 residues), 222.4 bits, see alignment E=3.3e-70 PF11575: FhuF_C" amino acids 218 to 238 (21 residues), 29.8 bits, see alignment (E = 2.1e-11)

Best Hits

KEGG orthology group: None (inferred from 81% identity to psa:PST_3703)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See L0GHJ1 at UniProt or InterPro

Protein Sequence (253 amino acids)

>Psest_0644 siderophore ferric iron reductase, AHA_1954 family (Pseudomonas stutzeri RCH2)
MHRNAEARWAQDDGLNDLLLRVRGALPGLDGRVGSPRPDELMLDRPQSLAALLAHWQAAH
PAAGRHYWAARCWTLLVWQPIYLQVLAVQLDGQAPCLDGMAQGVEQGFVAGFCLPAHQPL
RADSPRLLRHAGQQIRHFCEQAHAACGTLLGLHPKLAQRLAADCVMAALLHTLRTDGCGN
LQLCRCADAWLDACAMRGASGLLAVQLEDGGTRLGLQRKACCQHFRRADGELCDSCPKLP
LAERSRRLREQHG