Protein Info for HP15_611 in Marinobacter adhaerens HP15

Annotation: diguanylate cyclase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 transmembrane" amino acids 23 to 44 (22 residues), see Phobius details amino acids 56 to 75 (20 residues), see Phobius details amino acids 83 to 100 (18 residues), see Phobius details amino acids 104 to 120 (17 residues), see Phobius details amino acids 125 to 145 (21 residues), see Phobius details amino acids 156 to 175 (20 residues), see Phobius details TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 194 to 354 (161 residues), 162.4 bits, see alignment E=3.8e-52 PF00990: GGDEF" amino acids 197 to 353 (157 residues), 156.1 bits, see alignment E=6.9e-50 PF22335: Cas10-Cmr2_palm2" amino acids 275 to 354 (80 residues), 27.1 bits, see alignment E=4.1e-10

Best Hits

KEGG orthology group: None (inferred from 73% identity to maq:Maqu_2407)

Predicted SEED Role

"FIG00784194: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See E4PP63 at UniProt or InterPro

Protein Sequence (363 amino acids)

>HP15_611 diguanylate cyclase (Marinobacter adhaerens HP15)
MPQTARKTPDTELSQFRVKGEIPVPILINWLTAVAVPLLCFFAWRSSLQNDPITPPLLVG
FAVLLAVNSVSYLLFGNKTLQRRGFITLITVLFTYLAINAVEDGSAIIWLFAYPPIIFYI
SESRVGLLACCGGFAAVIFLFSPLGDFLFEPPHSTSFRITMIAVLGFEMVTCYILDQSRR
RSKLGLLKLAAEFEYAAKHDALTGLANRREALEQLDIEYQRYLRNARPFSVLLMDIDLFK
SVNDNYGHHVGDELIILVARTLREQCRKVDTLARWGGEEYLVLLPETNTGEALASANRIR
EAFAVRSVSTEQGPIQATISVGVASIRGSESIDRLLQRSDEALYRAKSEGRNRACGYENE
AAA