Protein Info for PGA1_c06370 in Phaeobacter inhibens DSM 17395

Annotation: adenine phosphoribosyltransferase Apt

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01090: adenine phosphoribosyltransferase
  • amino acids 7 to 175 (169 residues), 226.4 bits, E=1.1e-71
• PF00156: Pribosyltran
  • amino acids 48 to 157 (110 residues), 60.2 bits, E=7.6e-21

Best Hits

Swiss-Prot: 89% identical to APT_RUEPO: Adenine phosphoribosyltransferase (apt) from Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3)

KEGG orthology group: K00759, adenine phosphoribosyltransferase [EC: 2.4.2.7] (inferred from 89% identity to sil:SPO3066)

MetaCyc: 64% identical to adenine phosphoribosyltransferase (Sinorhizobium meliloti 1021)
Adenine phosphoribosyltransferase. [EC: 2.4.2.7]

Predicted SEED Role

"Adenine phosphoribosyltransferase (EC 2.4.2.7)" in subsystem Purine conversions or cAMP signaling in bacteria (EC 2.4.2.7)

MetaCyc Pathways

• superpathway of purine nucleotide salvage (13/14 steps found)
• adenine salvage (3/3 steps found)
• adenine and adenosine salvage I (2/2 steps found)
• adenine and adenosine salvage II (2/2 steps found)
• guanine and guanosine salvage I (2/2 steps found)
• guanine and guanosine salvage II (2/2 steps found)
• superpathway of guanine and guanosine salvage (2/3 steps found)
• glyphosate degradation III (4/7 steps found)
• (aminomethyl)phosphonate degradation (4/8 steps found)

KEGG Metabolic Maps

• Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.7

Sequence Analysis Tools

See I7EUI6 at UniProt or InterPro

Protein Sequence (179 amino acids)

>PGA1_c06370 adenine phosphoribosyltransferase Apt (Phaeobacter inhibens DSM 17395)
MARKTAVKDYIRTIVDFPHEGIMFRDVTTLFADPRGFRMAIDQMLHPYAGEQIDKVVGLE
ARGFILGGAIAHQLSVGFVPIRKKGKLPGTTISQEYKLEYGEAIMEIHDDAIQPGEKILV
VDDLLATGGTAAAGIKLIERLGGEIVSCAFIIDLPELGGRKVLEDLGMDVTVLCEFEGA