Protein Info for PGA1_c06350 in Phaeobacter inhibens DSM 17395

Annotation: putative MFS-type transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 16 to 38 (23 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 76 to 96 (21 residues), see Phobius details amino acids 102 to 125 (24 residues), see Phobius details amino acids 137 to 156 (20 residues), see Phobius details amino acids 168 to 188 (21 residues), see Phobius details amino acids 220 to 242 (23 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 342 to 365 (24 residues), see Phobius details amino acids 371 to 394 (24 residues), see Phobius details PF07690: MFS_1" amino acids 22 to 254 (233 residues), 80.6 bits, see alignment E=1.1e-26 amino acids 248 to 402 (155 residues), 65.2 bits, see alignment E=5.3e-22 PF06779: MFS_4" amino acids 35 to 378 (344 residues), 38.4 bits, see alignment E=1e-13

Best Hits

KEGG orthology group: None (inferred from 61% identity to jan:Jann_0943)

Predicted SEED Role

"Probable oxalate/formate antiporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWZ0 at UniProt or InterPro

Protein Sequence (406 amino acids)

>PGA1_c06350 putative MFS-type transporter (Phaeobacter inhibens DSM 17395)
MSTSAILDSRYSWTRLLVTLAIATVANVGMWAVIVVMPAVEVEFGADRAAASLPYTLTMI
GFAVGNLVIGRLVDRFGITLALCAAALLSAISYGLAMLAPDMIWLSAAHLFLGLGTAAGF
GPLIADISHWFQRRRGIAVALVASGNYLSGAIWPTALADMLAESGWRSVYATLAVVTLLV
VVPLSLVLRRRIAFDAQGDSAAVSASNAARVGLSPRQLQWILGLAGIGCCVAMSMPQVHI
VAYCVGLGYGPTVGAEMLSLMLLGGVVSRVISGLVADRFGGVRTLLVGSILQCVALFLYL
PYDGMVSLYLVSAIFGLAQGGIVPSYALVVREYMPPQEAGTRVGFVMMMTILGMALGGWM
SGWIYDVSGSYQLAFVNGIFWNGLNIAIMMLLLMRSRPARPRMQPA