Protein Info for PGA1_c06330 in Phaeobacter inhibens DSM 17395

Annotation: putative ribosomal-protein-alanine acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 196 PF13302: Acetyltransf_3" amino acids 14 to 159 (146 residues), 89.2 bits, see alignment E=6.1e-29 PF00583: Acetyltransf_1" amino acids 71 to 158 (88 residues), 33.8 bits, see alignment E=5.7e-12 PF13420: Acetyltransf_4" amino acids 74 to 177 (104 residues), 32.1 bits, see alignment E=1.6e-11

Best Hits

KEGG orthology group: K03790, ribosomal-protein-alanine N-acetyltransferase [EC: 2.3.1.128] (inferred from 81% identity to sit:TM1040_2328)

Predicted SEED Role

"Ribosomal-protein-S5p-alanine acetyltransferase" in subsystem Ribosomal protein S5p acylation or Ribosome biogenesis bacterial

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.128

Use Curated BLAST to search for 2.3.1.128

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EJL8 at UniProt or InterPro

Protein Sequence (196 amino acids)

>PGA1_c06330 putative ribosomal-protein-alanine acetyltransferase (Phaeobacter inhibens DSM 17395)
MLLTGRKVRIETERLTLRPPIHADFRDWAALRQHSLGYLTPWEPSWAADHLSRKSFTNRV
YWARRAVSSGSALPLFLIRRSDQLLVGAITLDNIRRGPAQAGTLGYWTGQPFARHGYMRE
AIGAVVHHAFTKLDLSRIEAACLPENAASRGLLESAGFKYEGVAQSYLQINGRWRTHVLY
ASLRHDRRGRTQVGQA