Protein Info for HP15_601 in Marinobacter adhaerens HP15

Annotation: gamma-glutamyl phosphate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00171: Aldedh
  • amino acids 10 to 282 (273 residues), 65 bits, E=2.5e-22
  • amino acids 307 to 374 (68 residues), 27.4 bits, E=6.6e-11
• TIGR00407: glutamate-5-semialdehyde dehydrogenase
  • amino acids 14 to 407 (394 residues), 507.2 bits, E=1.5e-156

Best Hits

Swiss-Prot: 87% identical to PROA_MARHV: Gamma-glutamyl phosphate reductase (proA) from Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 87% identity to maq:Maqu_2417)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

• L-citrulline biosynthesis (7/8 steps found)
• L-proline biosynthesis I (from L-glutamate) (4/4 steps found)
• L-ornithine biosynthesis II (3/3 steps found)
• superpathway of L-citrulline metabolism (9/12 steps found)
• L-N^δ-acetylornithine biosynthesis (5/7 steps found)

KEGG Metabolic Maps

• Arginine and proline metabolism
• Urea cycle and metabolism of amino groups

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

See E4PP53 at UniProt or InterPro

Protein Sequence (418 amino acids)

>HP15_601 gamma-glutamyl phosphate reductase (Marinobacter adhaerens HP15)
MDIAAYMAEVGQQARAAATGVARSTTAVRNQALLATAEALDAAREELALANGKDLQMGRE
NGLDAAMLDRLELTPQRIDTMIEGLRQVASLPDPIGAITDMNYRPSGIQVGKMRVPLGVI
GIIYESRPNVTVEAASLCLKSGNATILRGGSESIHSNQAIARCLSAGLAKAGLPENAVQV
IKTTDRAAVGELITMPDYVDVIVPRGGKGLIERISRDARVPVIKHLDGVCHVYIDSHADP
EKALKVAINAKTHRYGTCNTMETLLVDAEIAEDILPLLAQAFVEKGVELRGCERTRAIVE
GVVEATEADWEAEYLAPVLAVRVVDGLEGAIAHINRYSSQHTDSIITENYTRARRFITEV
DSSSVMVNASTRFADGFEYGLGAEIGISTDKIHARGPVGLEGLTSQKYVVFGDGHIRT