Protein Info for PGA1_c06250 in Phaeobacter inhibens DSM 17395

Annotation: cytochrome c oxidase subunit 2

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 279 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 54 to 76 (23 residues), see Phobius details amino acids 97 to 115 (19 residues), see Phobius details PF02790: COX2_TM" amino acids 32 to 115 (84 residues), 82.1 bits, see alignment E=2.6e-27 TIGR02866: cytochrome c oxidase, subunit II" amino acids 42 to 261 (220 residues), 200.2 bits, see alignment E=1.3e-63 PF00116: COX2" amino acids 129 to 251 (123 residues), 156.9 bits, see alignment E=2e-50

Best Hits

Swiss-Prot: 63% identical to COX2_PARDE: Cytochrome c oxidase subunit 2 (ctaC) from Paracoccus denitrificans

KEGG orthology group: K02275, cytochrome c oxidase subunit II [EC: 1.9.3.1] (inferred from 76% identity to sil:SPO3076)

Predicted SEED Role

"Cytochrome c oxidase polypeptide II (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See I7EWY1 at UniProt or InterPro

Protein Sequence (279 amino acids)

>PGA1_c06250 cytochrome c oxidase subunit 2 (Phaeobacter inhibens DSM 17395)
MKNALMLSGLFSGLSSLPAMAQEGLETIGKPVDGGLGFQPAATELAEGIHSLDYMILVII
TAVCVFVGGLLLYAIVRFNRRANPNASQFTHNTPIEIAWTVVPILILVFIGSFSLPELFR
QQEIPEGDITIKVTGYQWYWGYEYVDHEFGFESFMLAKEDLADNGYAEDEYLLATDTAVV
VPVGKTVVMQVTGADVIHSWTIPAFGVKQDAVPGRLAELWFKADKEGIYFGQCSELCGKD
HAYMPITVKVVSQEAYDAWLEGAIEEYAGLPQSYQVASN